Property Summary

NCBI Gene PubMed Count 12
PubMed Score 129.25
PubTator Score 52.15

Knowledge Summary


No data available


Gene RIF (1)

22820137 ARSD protein level and IGVH were independently associated with the need for therapy of chronic lymphocytic leukemia patients.

AA Sequence

QFSMSNILWKPWLQPCCGHFPFCSCHEDGDGTP                                         561 - 593

Text Mined References (15)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22820137 Gene expression profiling identifies ARSD as a new marker of disease progression and the sphingolipid metabolism as a potential novel metabolism in chronic lymphocytic leukemia.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14699613 2004 Longterm follow-up in chondrodysplasia punctata, tibia-metacarpal type, demonstrating natural history.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11177574 2000 Arylsulfatase D gene in Xp22.3 encodes two protein isoforms.
11027669 2000 Expression profiling of human sulfotransferase and sulfatase gene superfamilies in epithelial tissues and cultured cells.
9246409 1997 Comparative mapping of Xp22 genes in hominoids--evolutionary linear instability of their Y homologues.
9192838 1997 Identification by shotgun sequencing, genomic organization, and functional analysis of a fourth arylsulfatase gene (ARSF) from the Xp22.3 region.
8845834 1996 Characterization of a cluster of sulfatase genes on Xp22.3 suggests gene duplications in an ancestral pseudoautosomal region.
7720070 1995 A cluster of sulfatase genes on Xp22.3: mutations in chondrodysplasia punctata (CDPX) and implications for warfarin embryopathy.