Property Summary

NCBI Gene PubMed Count 115
PubMed Score 319.04
PubTator Score 650.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Leukodystrophy, Metachromatic 1 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 1.0e-07
malignant mesothelioma 3232 1.0e-05
Disease Target Count Z-score Confidence
Leukodystrophy 55 0.0 4.0
Disease Target Count
Metachromatic leukodystrophy 14

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma -2.200 1.0e-05
osteosarcoma -1.652 1.0e-07

Protein-protein Interaction (4)

PDB (10)

Gene RIF (43)

AA Sequence

MGAPRSLLLALAAGLAVARPPNIVLIFADDLGYGDLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSLCT      1 - 70
PSRAALLTGRLPVRMGMYPGVLVPSSRGGLPLEEVTVAEVLAARGYLTGMAGKWHLGVGPEGAFLPPHQG     71 - 140
FHRFLGIPYSHDQGPCQNLTCFPPATPCDGGCDQGLVPIPLLANLSVEAQPPWLPGLEARYMAFAHDLMA    141 - 210
DAQRQDRPFFLYYASHHTHYPQFSGQSFAERSGRGPFGDSLMELDAAVGTLMTAIGDLGLLEETLVIFTA    211 - 280
DNGPETMRMSRGGCSGLLRCGKGTTYEGGVREPALAFWPGHIAPGVTHELASSLDLLPTLAALAGAPLPN    281 - 350
VTLDGFDLSPLLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASSSL    351 - 420
TAHEPPLLYDLSKDPGENYNLLGGVAGATPEVLQALKQLQLLKAQLDAAVTFGPSQVARGEDPALQICCH    421 - 490
PGCTPRPACCHCPDPHA                                                         491 - 507
//

Text Mined References (130)

PMID Year Title