Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.44
PubTator Score 4.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Astrocytoma, Pilocytic 1.700 3.0e-06
Breast cancer -1.700 7.0e-09
breast carcinoma -1.100 2.4e-18
chronic lymphosyte leukemia -1.200 1.3e-09
diabetes mellitus -1.200 1.1e-02
ependymoma 1.900 3.6e-11
Hydrolethalus syndrome 2.473 3.6e-02
invasive ductal carcinoma -1.162 2.5e-03
juvenile dermatomyositis 1.219 2.7e-11
lung adenocarcinoma -1.300 6.6e-12
medulloblastoma -1.200 4.5e-04
medulloblastoma, large-cell -1.400 3.0e-04
non-small cell lung cancer -1.305 1.7e-10
ovarian cancer -4.200 1.0e-09
Pick disease 1.300 3.8e-02
subependymal giant cell astrocytoma 3.142 8.1e-03
tuberculosis and treatment for 6 months 1.300 4.5e-04

Gene RIF (3)

AA Sequence

MGGEAGCAAAVGAEGRVKSLGLVFEDERKGCYSSGETVAGHVLLEASEPVALRALRLEAQGRATAAWGPS      1 - 70
TCPRASASTAALAVFSEVEYLNVRLSLREPPAGEGIILLQPGKHEFPFRFQLPSEPLVTSFTGKYGSIQY     71 - 140
CVRAVLERPKVPDQSVKRELQVVSHVDVNTPALLTPVLKTQEKMVGCWFFTSGPVSLSAKIERKGYCNGE    141 - 210
AIPIYAEIENCSSRLIVPKAAIFQTQTYLASGKTKTIRHMVANVRGNHIASGSTDTWNGKTLKIPPVTPS    211 - 280
ILDCCIIRVDYSLAVYIHIPGAKKLMLELPLVIGTIPYNGFGSRNSSIASQFSMDMSWLTLTLPEQPEAP    281 - 350
PNYADVVSEEEFSRHIPPYPQPPNCEGEVCCPVFACIQEFRFQPPPLYSEVDPHPSDVEESQPVSFIL      351 - 418
//

Text Mined References (14)

PMID Year Title