Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
osteosarcoma -1.174 2.2e-04
ependymoma -1.200 3.1e-06
group 4 medulloblastoma -1.800 6.9e-05
atypical teratoid/rhabdoid tumor -1.500 2.3e-06
medulloblastoma, large-cell -1.700 3.8e-05
pancreatic ductal adenocarcinoma liver m... 1.004 1.9e-02
tuberculosis -1.200 1.5e-05
intraductal papillary-mucinous adenoma (... 1.200 9.0e-04
intraductal papillary-mucinous carcinoma... 1.100 1.4e-03
diabetes mellitus -1.200 9.7e-03
pediatric high grade glioma -1.100 1.3e-03
lung adenocarcinoma -2.200 3.4e-16
lung carcinoma -1.200 3.5e-09

Synonym

Accession Q8TBH0 B2RBG9 O95895 Q6ZRV9 Q8WYG6
Symbols PP2703
CLONE24945

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MLFDKVKAFSVQLDGATAGVEPVFSGGQAVAGRVLLELSSAARVGALRLRARGRAHVHWTESRSAGSSTA      1 - 70
YTQSYSERVEVVSHRATLLAPDTGETTTLPPGRHEFLFSFQLPPTLVTSFEGKHGSVRYCIKATLHRPWV     71 - 140
PARRARKVFTVIEPVDINTPALLAPQAGAREKVARSWYCNRGLVSLSAKIDRKGYTPGEVIPVFAEIDNG    141 - 210
STRPVLPRAAVVQTQTFMARGARKQKRAVVASLAGEPVGPGQRALWQGRALRIPPVGPSILHCRVLHVDY    211 - 280
ALKVCVDIPGTSKLLLELPLVIGTIPLHPFGSRSSSVGSHASFLLDWRLGALPERPEAPPEYSEVVADTE    281 - 350
EAALGQSPFPLPQDPDMSLEGPFFAYIQEFRYRPPPLYSEEDPNPLLGDMRPRCMTC                 351 - 407
//

Text Mined References (7)

PMID Year Title
23236378 2012 Mammalian ? arrestins link activated seven transmembrane receptors to Nedd4 family e3 ubiquitin ligases and interact with ? arrestins.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.