Property Summary

NCBI Gene PubMed Count 35
PubMed Score 86.33
PubTator Score 459.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Retinitis Pigmentosa 226 3.467 1.7

Expression

Gene RIF (18)

AA Sequence

MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYLKCRKLFVMLTCAFRYGRDDLEVIGLT      1 - 70
FRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVTLQPGPEDAGKPCGID     71 - 140
FEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPSAQTIRRFLLSAQPLQLQAWMDREVHYHGEP    141 - 210
ISVNVSINNCTNKVIKKIKISVDQITDVVLYSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQ    211 - 280
KRGLALDGKLKHEDTNLASSTIIRPGMDKELLGILVSYKVRVNLMVSCGGILGDLTASDVGVELPLVLIH    281 - 350
PKPSHEAASSEDIVIEEFTRKGEEESQKAVEAEGDEGS                                    351 - 388
//

Text Mined References (36)

PMID Year Title