Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1076.90
PubTator Score 10.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytoma -4.800 1.5e-07
ependymoma -5.500 5.0e-04
oligodendroglioma -3.700 2.9e-03
glioblastoma -6.300 6.2e-09
osteosarcoma -1.415 1.9e-02
medulloblastoma -6.400 7.1e-11
atypical teratoid / rhabdoid tumor -6.600 1.1e-14
medulloblastoma, large-cell -6.100 2.2e-05
primitive neuroectodermal tumor -6.100 2.2e-06
Amyotrophic Lateral Sclerosis 1.152 5.1e-06
acute quadriplegic myopathy 1.821 4.4e-08
juvenile dermatomyositis 1.609 5.7e-13
lung cancer 1.200 1.4e-03
pediatric high grade glioma -4.700 3.2e-06
pilocytic astrocytoma -4.200 6.0e-06
non primary Sjogren syndrome sicca -1.100 2.4e-02
subependymal giant cell astrocytoma -3.019 3.7e-02
Pick disease -1.300 2.2e-02
progressive supranuclear palsy 1.200 1.4e-02
pituitary cancer -2.600 9.6e-04

Gene RIF (2)

PMID Text
24127197 Interstitial deletion of 3p22.3p22.2 encompassing ARPP21 and CLASP2 is a potential pathogenic factor for a syndromic form of intellectual disability.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSEQGDLNQAIAEEGGTEQETATPENGIVKSESLDEEEKLELQRRLEAQNQERRKSKSGAGKGKLTRSLA      1 - 70
VCEESSARPGGESLQDQESIHLQLSSFSSLQEEDKSRKDDSEREKEKDKNKDKTSEKPKIRMLSKDCSQE     71 - 140
YTDSTGIDLHEFLINTLKNNSRDRMILLKMEQEIIDFIADNNNHYKKFPQMSSYQRMLVHRVAAYFGLDH    141 - 210
NVDQTGKSVIINKTSSTRIPEQRFCEHLKDEKGEESQKRFILKRDNSSIDKEDNQQNRMHPFRDDRRSKS    211 - 280
IEEREEEYQRVRERIFAHDSVCSQESLFVENSRLLEDSNICNETYKKRQLFRGNRDGSGRTSGSRQSSSE    281 - 350
NELKWSDHQRAWSSTDSDSSNRNLKPAMTKTASFGGITVLTRGDSTSSTRSTGKLSKAGSESSSSAGSSG    351 - 420
SLSRTHPPLQSTPLVSGVAAGSPGCVPYPENGIGGQVAPSSTSYILLPLEAATGIPPGSILLNPHTGQPF    421 - 490
VNPDGTPAIYNPPTSQQPLRSAMVGQSQQQPPQQQPSPQPQQQVQPPQPQMAGPLVTQRDDVATQFGQMT    491 - 560
LSRQSSGETPEPPSGPVYPSSLMPQPAQQPSYVIASTGQQLPTGGFSGSGPPISQQVLQPPPSPQGFVQQ    561 - 630
PPPAQMPVYYYPSGQYPTSTTQQYRPMAPVQYNAQRSQQMPQAAQQAGYQPVLSGQQGFQGLIGVQQPPQ    631 - 700
SQNVINNQQGTPVQSVMVSYPTMSSYQVPMTQGSQGLPQQSYQQPIMLPNQAGQGSLPATGMPVYCNVTP    701 - 770
PTPQNNLRLIGPHCPSSTVPVMSASCRTNCASMSNAGWQVKF                                771 - 812
//

Text Mined References (18)

PMID Year Title
24127197 2013 Interstitial deletion of 3p22.3p22.2 encompassing ARPP21 and CLASP2 is a potential pathogenic factor for a syndromic form of intellectual disability: a co-morbidity model with additional copy number variations in a large family.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15499021 2004 A network of control mediated by regulator of calcium/calmodulin-dependent signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
15096520 2004 Loss of CARM1 results in hypomethylation of thymocyte cyclic AMP-regulated phosphoprotein and deregulated early T cell development.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10854908 2000 Drugs of abuse modulate the phosphorylation of ARPP-21, a cyclic AMP-regulated phosphoprotein enriched in the basal ganglia.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8120638 1994 Expression of mRNAs encoding ARPP-16/19, ARPP-21, and DARPP-32 in human brain tissue.