Property Summary

NCBI Gene PubMed Count 13
PubMed Score 19.96
PubTator Score 11.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Multiple myeloma 2.121 3.6e-03
astrocytoma -3.300 8.8e-05
ependymoma -2.200 8.4e-03
oligodendroglioma -1.700 1.6e-17
psoriasis 1.900 1.9e-04
glioblastoma -2.800 2.0e-04
osteosarcoma 1.240 7.5e-03
medulloblastoma -2.100 4.1e-07
atypical teratoid / rhabdoid tumor -2.700 4.6e-08
medulloblastoma, large-cell -2.800 7.5e-05
primitive neuroectodermal tumor -2.000 2.8e-04
hereditary spastic paraplegia -1.419 7.9e-03
tuberculosis -1.100 1.2e-07
Parkinson's disease -1.400 1.9e-02
adult high grade glioma -2.300 6.4e-04
pilocytic astrocytoma -1.800 6.9e-05
Pick disease -1.300 5.2e-04
ovarian cancer 1.800 3.2e-03

Gene RIF (4)

PMID Text
25736597 Data show that micrRNA miR-320a directly targets cAMP-regulated phosphoprotein 19 (ARPP-19) and estrogen-related receptor gamma protein (ERRgamma) in breast cancer cell lines.
25547487 ARPP-19 may play a role in HCC pathogenesis through regulating cell proliferation.
21509594 ARPP19 gene expression is decreased in follicular variant of papillary thyroid carcinoma.
11771749 Decreased levels of ARPP-19 and PKA in brains of Down syndrome and Alzheimer's disease.

AA Sequence

MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKA      1 - 70
KMKNKQLPTAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG                                 71 - 112
//

Text Mined References (22)

PMID Year Title
25736597 2015 MicroRNA-320a sensitizes tamoxifen-resistant breast cancer cells to tamoxifen by targeting ARPP-19 and ERR?.
25547487 2014 Increased ARPP-19 expression is associated with hepatocellular carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21509594 2011 Differential expression of a set of genes in follicular and classic variants of papillary thyroid carcinoma.
21269460 2011 Initial characterization of the human central proteome.
21164014 2010 The substrate of Greatwall kinase, Arpp19, controls mitosis by inhibiting protein phosphatase 2A.
20218812 2010 miR-451 enhances erythroid differentiation in K562 cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17893145 2007 Conformation-specific binding of alpha-synuclein to novel protein partners detected by phage display and NMR spectroscopy.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11279279 2001 ARPP-16/ARPP-19: a highly conserved family of cAMP-regulated phosphoproteins.
10754390 Identification of okadaic-acid-induced genes by mRNA differential display in glioma cells.
9653196 1998 Human alpha-endosulfine, a possible regulator of sulfonylurea-sensitive KATP channel: molecular cloning, expression and biological properties.
8687439 1996 Alpha endosulfine is a novel molecule, structurally related to a family of phosphoproteins.
8120638 1994 Expression of mRNAs encoding ARPP-16/19, ARPP-21, and DARPP-32 in human brain tissue.
2160982 1990 Purification and cDNA cloning of ARPP-16, a cAMP-regulated phosphoprotein enriched in basal ganglia, and of a related phosphoprotein, ARPP-19.