Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.43
PubTator Score 9.18

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... -1.300 2.7e-04
osteosarcoma 1.575 2.8e-06
posterior fossa group B ependymoma 1.100 3.2e-08
psoriasis 1.100 1.4e-02
tuberculosis 1.700 4.6e-06

Synonym

Accession Q7Z6K5 E2QRD5
Symbols C15orf38

Gene

  Ortholog (1)

Species Source Disease
Inparanoid EggNOG

Gene RIF (4)

AA Sequence

MSRIYHDGALRNKAVQSVRLPGAWDPAAHQGGNGVLLEGELIDVSRHSILDTHGRKERYYVLYIRPSHIH      1 - 70
RRKFDAKGNEIEPNFSATRKVNTGFLMSSYKVEAKGDTDRLTPEALKGLVNKPELLALTESLTPDHTVAF     71 - 140
WMPESEMEVMELELGAGVRLKTRGDGPFLDSLAKLEAGTVTKCNFTGDGKTGASWTDNIMAQKCSKGAAA    141 - 210
EIREQGDGAEDEEWDD                                                          211 - 226
//

Text Mined References (14)

PMID Year Title