Property Summary

NCBI Gene PubMed Count 28
PubMed Score 16.55
PubTator Score 11.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7766 2.4e-06
ovarian cancer 8297 2.4e-05
diabetes mellitus 1683 2.2e-03
breast carcinoma 1589 8.3e-03

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma 1.600 8.3e-03
diabetes mellitus -1.700 2.2e-03
osteosarcoma -1.734 2.4e-06
ovarian cancer -1.700 2.4e-05

Protein-protein Interaction (11)

Gene RIF (4)

AA Sequence

MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIY      1 - 70
ITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQET     71 - 140
GLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ                                    141 - 178
//

Text Mined References (34)

PMID Year Title