Property Summary

NCBI Gene PubMed Count 40
PubMed Score 16.86
PubTator Score 7.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (15)

AA Sequence

MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAH      1 - 70
GADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGEN     71 - 140
RAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELK    141 - 210
DTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRA    211 - 280
RPDAEKKEMKTITGKTFSSR                                                      281 - 300
//

Text Mined References (45)

PMID Year Title