1. Home
  2. Targets
  3. cytoskeletal protein
  4. actin family cytoskeletal protein
  5. Actin-related protein 2/3 complex subunit 1B

Tbio Actin-related protein 2/3 complex subunit 1B

Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.

This gene encodes one of seven subunits of the human Arp2/3 protein complex. This subunit is a member of the SOP2 family of proteins and is most similar to the protein encoded by gene ARPC1A. The similarity between these two proteins suggests that they both may function as p41 subunit of the human Arp2/3 complex that has been implicated in the control of actin polymerization in cells. It is possible that the p41 subunit is involved in assembling and maintaining the structure of the Arp2/3 complex. Multiple versions of the p41 subunit may adapt the functions of the complex to different cell types or developmental stages. This protein also has a role in centrosomal homeostasis by being an activator and substrate of the Aurora A kinase. [provided by RefSeq, Mar 2011]

 Comments

Property Summary

NCBI Gene PubMed Count 28
PubMed Score 12.35
PubTator Score 10.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Synonym

Accession O15143 Q9BU00
Symbols ARC41
p40-ARC
p41-ARC

Gene

ARPC1B

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (11)

See all...

 GO Function (1)

 GO Component (6)

 GO Process (5)

 Compartment GO Term (35)

See all...

 IMPC Phenotype (6)

 MGI Phenotype (4)

 HCA RNA Cell Line (56)

See all...

Pathway (30)

See all...

Protein-protein Interaction (116)

IGKV2-28   IGKV2D-30   IGKV3D-20   IGKV1-12   IGLC7   WIPF3   MYO1C   WASL   PIK3R2   ARPC2   ARPC3   EPHB6   WIPF1   ABL1   IGKV1D-33   IGKV1-33   IGKV1-39   IGKV1-17   IGKV1D-16   IGKV1-5   IGKV1D-12   IGKV2D-40   IGKV2D-28   IGKV3-20   IGKV3-15   IGLV1-44   IGLV1-47   IGLV1-51   IGLV1-40   IGLV2-14   IGLV2-23   IGLV2-11   IGLV2-8   IGLV3-19   IGLV3-1   IGLV3-25   IGLV3-27   IGLV6-57   IGHV1-69   IGHV1-46   IGHV3-11   IGHV3-48   IGHV3-23   IGHV3-13   IGHV3-53   IGHV3-30   IGHV3-33   IGHV3-7   IGHV3-9   IGHV2-70   IGHV2-5   IGHV4-39   IGHV4-59   IGKC   IGHG1   IGHG2   IGHG3   IGHG4   IGLV7-43   IGKV1-16   IGKV1D-39   IGKV3-11   IGKV2-30   IGKV4-1   IGKV5-2   IGHV4-34   FCGR3A   CD3G   IGLC6   IGLC1   IGLC2   IGLC3   FCGR1A   FCGR2A   NCK1   CD247   IGHV1-2   PIK3R1   EPHB2   PIK3CA   PIK3CB   WAS   SYK   EFNB2   EPHB3   EPHB4   EPHB1   NCKAP1L   ARPC4   CDC42   ACTR3   ACTR2   GRB2   RAC1   IGLV3-21   EFNB1   PTK2   LCP2   EFNB3   ITSN1   CYFIP1   ABI1   WIPF2   BRK1   CYFIP2   MYO10   NCKIPSD   MYH2   BAIAP2   NCKAP1   WASF2   ARPC5L   ARPC5   ACTR3B   POGK   NT5C  

Gene RIF (5)

PMID Text
21628992 p41-Arc activates a senescence program in p53- and Rb-independent ways.
20603326 Arpc1b is both a physiological activator and substrate of Aurora A kinase and these interactions help to maintain mitotic integrity in mammalian cells.
16723437 From the analysis of the different radio-sensitivity cancer cell lines, the Arpc1b gene was selected as a prediction marker gene for sensitivity of CMM to radiotherapy.
14749719 Phosphorylation of p41-ARC by p21-activated kinase 1.
12115587 INSIG1 and p41 Arp2/3 complex (p41-Arc)reduced expression might be involved in gastric cancer development or progression

AA Sequence 

MAYHSFLVEPISCHAWNKDRTQIAICPNNHEVHIYEKSGAKWTKVHELKEHNGQVTGIDWAPESNRIVTC      1 - 70
GTDRNAYVWTLKGRTWKPTLVILRINRAARCVRWAPNENKFAVGSGSRVISICYFEQENDWWVCKHIKKP     71 - 140
IRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGSKMPFGELMFESSSSCGWVHGVCF    141 - 210
SASGSRVAWVSHDSTVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLS    211 - 280
FGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGM    281 - 350
DGGMSIWDVKSLESALKDLKIK                                                    351 - 372
//

Text Mined References (37)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21628992 2011 p41-Arc, a regulatory subunit of Arp2/3 complex, can induce premature senescence in the absence of p53 and Rb.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20603326 2010 Arpc1b, a centrosomal protein, is both an activator and substrate of Aurora A.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16723437 2006 Arpc1b gene is a candidate prediction marker for choroidal malignant melanomas sensitive to radiotherapy.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15894313 2005 Subconfluent endothelial cells form podosomes downstream of cytokine and RhoGTPase signaling.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15279900 2004 Decreased expression of the seven ARP2/3 complex genes in human gastric cancers.
14749719 2004 p41-Arc subunit of human Arp2/3 complex is a p21-activated kinase-1-interacting substrate.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12115587 2002 Reduced expression of the insulin-induced protein 1 and p41 Arp2/3 complex genes in human gastric cancers.
11943145 2002 The acidic regions of WASp and N-WASP can synergize with CDC42Hs and Rac1 to induce filopodia and lamellipodia.
11741539 2001 Reconstitution of human Arp2/3 complex reveals critical roles of individual subunits in complex structure and activity.
11721045 2001 Crystal structure of Arp2/3 complex.
11533442 2001 Structure of Arp2/3 complex in its activated state and in actin filament branch junctions.
10861055 2000 The polarization defect of Wiskott-Aldrich syndrome macrophages is linked to dislocalization of the Arp2/3 complex.
9359840 1997 Mammalian actin-related protein 2/3 complex localizes to regions of lamellipodial protrusion and is composed of evolutionarily conserved proteins.
9230079 1997 The human Arp2/3 complex is composed of evolutionarily conserved subunits and is localized to cellular regions of dynamic actin filament assembly.
9126924 1997 Lack of allelic exclusion in B cell chronic lymphocytic leukemia.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.