Property Summary

NCBI Gene PubMed Count 17
PubMed Score 696.94
PubTator Score 5.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.659 1.5e-05
non primary Sjogren syndrome sicca 1.400 1.9e-02
ovarian cancer 1.500 6.1e-03

Protein-protein Interaction (7)

Gene RIF (4)

AA Sequence

MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQWVKAHELKEHNGHITGIDWAPKSDRIVTC      1 - 70
GADRNAYVWSQKDGVWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFESENDWWVSKHIKKP     71 - 140
IRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVDEKPASTPWGSKMPFGQLMSEFGGSGTGGWVHGV    141 - 210
SFSASGSRLAWVSHDSTVSVADASKSVQVSTLKTEFLPLLSVSFVSENSVVAAGHDCCPMLFNYDDRGCL    211 - 280
TFVSKLDIPKQSIQRNMSAMERFRNMDKRATTEDRNTALETLHQNSITQVSIYEVDKQDCRKFCTTGIDG    281 - 350
AMTIWDFKTLESSIQGLRIM                                                      351 - 370
//

Text Mined References (18)

PMID Year Title