Property Summary

NCBI Gene PubMed Count 115
PubMed Score 607.35
PubTator Score 235.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Protein-protein Interaction (9)

Gene RIF (91)

PMID Text
27060253 Synchronized cells exhibit an autonomous ultradian mitochondrial respiratory activity which is abrogated by silencing the master clock gene BMAL1.
26915801 decreased expression of Bmal1 is correlated with tumor progression and poor prognosis in pancreatic ductal adenocarcinoma, with potential to be used as a biomarker for diagnosis and prognosis
26850841 when overexpressed, c-MYC is able to repress Per1 transactivation by BMAL1/CLOCK via targeting selective E-box sequences. Importantly, upon serum stimulation, MYC was detected in BMAL1 protein complexes
26753996 Our results indicate that activation of TGF-beta1 promotes the transcriptional induction of BMAL1.
26683776 Bmal1 could directly bind to the p53 gene promoter and thereby transcriptionally activate the downstream tumor suppressor pathway in a p53-dependent manner in pancreatic tumors.
26657859 define a regulatory mechanism that links chondrocyte BMAL1 to the maintenance and repair of cartilage
26562283 Data suggest that cryptochromes mediate periodic binding of Ck2b (casein kinase 2beta) to Bmal1 (aryl hydrocarbon receptor nuclear translocator-like protein) and thus inhibit Bmal1-Ser90 phosphorylation by Ck2a (casein kinase 2alpha). [SYNOPSIS]
26507264 ARNTL and PER1 were associated with PD.
26283580 a 4-locus CSNK1E haplotype encompassing the rs1534891 SNP (Z-score=2.685, permuted p=0.0076) and a 3-locus haplotype in ARNTL (Z-score=3.269, permuted p=0.0011) showed a significant association with Bipolar Disorder
26247999 possible circadian rhythm in full-term placental expression
26168277 In men undergoing acute total sleep deprivation, BMAL1 gene expression was decreased in skeletal muscle compared with controls.
26164627 these findings suggest that sumoylation plays a critical role in the spatiotemporal co-activation of CLOCK-BMAL1 by CBP for immediate-early Per induction and the resetting of the circadian clock.
26134245 CLOCK, ARNTL, and NPAS2 gene polymorphisms may have a role in seasonal variations in mood and behavior
25799324 rs2290036-C variant of ARNTL was over-represented in psychosis patients, and the variants rs934945-G and rs10462023-G of PER2 were associated with a more severe psychotic disorder
25741730 Bmal1-dependent oscillators of arginine vasopressin neurons modulate the coupling of the suprachiasmatic nucleus.
25480789 temporal signals of fasting and refeeding hormones regulate the transcription of Bmal1, a key transcription activator of molecular clock, in the liver
25310406 PER1 and BMAL1 operate as cell-autonomous modulators of human pigmentation and may be targeted for future therapeutic strategies
25203321 FAL1 associates with the epigenetic repressor BMI1 and regulates its stability in order to modulate the transcription of a number of genes including CDKN1A.
25182847 Data indicate that the inner nuclear membrane protein MAN1 directly binds the transcription activator BMAL1 promoter and enhances its transcription.
25175925 These results suggested that ARNTL may be a tumor suppressor and is epigenetically silenced in ovarian cancer.
25070164 There is not a significant difference in the expression of CLOCK, BMAL1, and PER1 in buccal epithelial cells of patients with essential arterial hypertension regardless of patient genotype.
24636202 The results of this study suggest that the ARNTL gene may be associated with the lithium prophylactic response in bipolar illness.
24418196 The rhythm of Bmal1 mRNA in human plaque-derived vascular smooth muscle cells is altered.
24277452 The progression-free survival of patients with high Bmal1 expression is significantly longer than that of patients with low Bmal1 expression.
24103761 These results suggest that DNA methylation of the BMAL1 gene is critical for interfering with circadian rhythms.
24005054 Knockdown of either BMAL1 or Period1 in human anagen hair follicles significantly prolonged anagen.
23606611 there is significant daily variation in PER2, PER3, and ARNTL1 expression with earlier timing of expression in women than in men
23584858 Data suggest that clock genes Per1, Cry1, Clock, and Bmal1 and their protein products may be directly involved in the daytime-dependent regulation and adaptation of hormone synthesis.
23563360 Bmal1 is a tumor suppressor, capable of suppressing cancer cell growth and invasiveness.
23546644 Studies indicate that in the cytoplasm, PER3 protein heterodimerizes with PER1, PER2, CRY1, and CRY2 proteins and enters into the nucleus, resulting in repression of CLOCK-BMAL1-mediated transcription.
23449886 Variants in ARNTL have been associated with seasonality and seasonal affective disorder, phenotypes that could reflect circadian rhythm disruption.
23395176 O-GlcNAc transferase (OGT) promotes expression of BMAL1/CLOCK target genes and affects circadian oscillation of clock genes in vitro and in vivo.
23358160 The SNPs most strongly associated in the single-marker analysis of the combined Danish samples were rs4757144 in ARNTL (P=3.78 x 10-6) and rs8057927 in CDH13.
23337503 this study demonstrated that BMAL1 was modified with an O-linked beta-N-acetylglucosamine (O-GlcNAc), which stabilized BMAL1 and enhanced its transcriptional activity.
23323702 These data document for the first time that the expression of BMAL1, PER3, PPARD and CRY2 genes is altered in gestational diabetes compared to normal pregnant women. deranged expression of clock genes may play a pathogenic role in GDM.
23229515 The phospho-mimicking S78E mutant of BMAL1 efficiently blocks DNA binding, which provides a molecular rationale for the possibility of rhythmic binding of CLOCK-BMAL1 during circadian cycle.
23206673 The data suggest that the impairment of the BMAL1 clock gene expression is closely associated with GDM susceptibility.
23129285 Expression of the CLOCK, BMAL1, and PER1 circadian genes in human oral mucosa cells as dependent on CLOCK gene polymorphic variants.
23033538 Data indicate that Clock-Bmal1 regulates the response to glucocorticoids in peripheral tissues through acetylation of the glucocorticoid receptor (GR), possibly antagonizing the biologic actions of diurnally fluctuating circulating cortisol.
23003921 DNA methylation levels at different CpG sites of CLOCK, BMAL1 and PER2 genes were analyzed in sixty normal-weight, overweight and obese women following a 16-week weight reduction program.
22990020 Data indicate that SNPs in SERPINE1 and ARNTL and an nucleotide polymorphisms (SNPs) associated with the expression of MUC3 were robustly associated with circulating levels of PAI-1.
22510946 findings indicate that BMAL1 has a critical role in MPM and could serve as an attractive therapeutic target for MPM
22217103 treatment with isoprenaline or dexamethasone induces circadian expression of hPer1, hPer2, hPer3, and hBMAL1
22105622 This study demonistraed that BMAL1 exhibited rhythmic expression in the control group, but not the Adult attention-deficit hyperactivity disorder group.
21990077 Examines the effect of acute sleep deprivation under light conditions on the expression of hPer2 and hBmal1. 40-hour acute sleep deprivation under light conditions may affect the expression of hPer2 in PBMCs.
21966465 Data conclude that BMAL1 is a crucial factor in the regulation of energy homeostasis, and disorders of the functions of BMAL1 lead to the development of metabolic syndrome.
21799909 rhythmic modulation of circulating microRNAs targeting Bmal1
21411511 Lean individuals exhibited significant (P < 0.05) temporal changes of core clock (PER1, PER2, PER3, CRY2, BMAL1, and DBP) and metabolic (REVERBalpha, RIP140, and PGC1alpha) genes.
21380491 Overexpression of the Bmal1 gene and reduced expression of the Per1 gene may thus be useful predictors of liver metastasis.
21363938 Data indicate that fetal adrenal gland showed circadian expression of Bmal-1 and Per-2 as well as of Mt1 and Egr-1.
20861012 ID2 can interact with the canonical clock components CLOCK and BMAL1 and mediate inhibitory effects on mPer1 expression
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20554694 Observational study of gene-disease association. (HuGE Navigator)
20446921 In this salivary gland cell line, there is a rhythm in the core oscillator components BMAL1 and REV-ERBalpha, an indication that circadian-based transcriptional regulation can be modelled in this peripheral cell type.
20368993 ARNTL and NPAS2 SNPs were associated with reproduction and with seasonal variation.
20368993 Observational study of gene-disease association. (HuGE Navigator)
20222832 There was no circadian rhythm of bmal1(brain and muscle ARNT-like 1) and cry1(cryptochrome 1) in PBMC of preterm neonates
20180986 Observational study of gene-disease association. (HuGE Navigator)
20174623 Observational study of gene-disease association. (HuGE Navigator)
20072116 Observational study of gene-disease association. (HuGE Navigator)
19934327 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19912323 results suggest that a peripheral molecular clock, as reflected in the dampened expression of the clock genes BMAL1 in total leukocytes, is altered in Parkinson's disease patients
19861640 BMAL1 mRNA levels were correlated only with age (beta = -.50, p < .001).
19861541 Epigenetic inactivation of the circadian clock gene BMAL1 is associated with hematologic malignancies.
19839995 Observational study of gene-disease association. (HuGE Navigator)
19693801 Observational study of gene-disease association. (HuGE Navigator)
19470168 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of aryl hydrocarbon receptor nuclear translocator-like (ARNTL) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19328558 Observational study of gene-disease association. (HuGE Navigator)
19296127 expression of BMAL1 is significantly associated with lymph node metastasis and poor prognosis in breast cancer
19277210 The shRNA barcode screening technique identified ARNTL as being involved in p53 regulation. cells having suppressed ARNTL are unable to arrest upon p53 activation associated with an inability to activate the p53 target gene p21(CIP1).
18663240 Several new polymorphisms in ARNTL gene are reported.
18587630 The transcription of human nocturnin gene displayed circadian oscillations in Huh7 cells (a human hepatoma cell line) and was regulated by CLOCK/BMAL1 heterodimer via the E-box of nocturnin promoter.
18517031 Individual PER3 rhythms correlated significantly with sleep-wake timing and the timing of melatonin and cortisol, but those of PER2 and BMAL1 did not reach significance.
18430226 The regulators of clock-controlled transcription PER2, CRY1 and CRY2 differ in their capacity to interact with each single component of the BMAL1-CLOCK heterodimer and, in the case of BMAL1, also in their interaction sites.
18411297 DEC1, along with DEC2, plays a role in the finer regulation and robustness of the molecular clock CLOCK/BMAL1
18228528 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17994337 CLOCK/BMAL1-mediated activation of PER1 by AP1 and E-Box elements is distinct from peripheral transcriptional modulation via cAMP-induced CREB and C/EBP.
17728404 Observational study of gene-disease association. (HuGE Navigator)
17728404 rat models to human provides evidence of a causative role of Bmal1 variants in pathological components of the metabolic syndrome
17457720 variations associated with seasonal affective disorder
17274950 We have examined the circadian expression of clock genes in human leukocytes and found that Bmal1 mRNA showed weak rhythm.
16628007 the CLOCK(NPAS2)/BMAL1 complex is post-translationally regulated by cry1 and cry2
16528748 Observational study of gene-disease association. (HuGE Navigator)
16507006 Observational study of gene-disease association. (HuGE Navigator)
16474406 a molecular genetic screen in mammalian cells to identify mutants of the circadian transcriptional activators CLOCK and BMAL1.
14750904 Transcripts of BMAL1 underwent circadian oscillation.
12897057 BMAL1 and CLOCK have roles in circadian system control
11875063 The circadian regulatory proteins BMAL1 and cryptochromes are substrates of casein kinase Iepsilon.

AA Sequence

MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRI      1 - 70
KNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPT     71 - 140
FLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSS    141 - 210
SDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKADRKSFC    211 - 280
TIHSTGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKF    281 - 350
VFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRW    351 - 420
FSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRA    421 - 490
GAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQE    491 - 560
NPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL        561 - 626
//

Text Mined References (121)

PMID Year Title
27060253 2016 Clock-genes and mitochondrial respiratory activity: Evidence of a reciprocal interplay.
26915801 2016 Decreased circadian component Bmal1 predicts tumor progression and poor prognosis in human pancreatic ductal adenocarcinoma.
26850841 2016 c-MYC targets the central oscillator gene Per1 and is regulated by the circadian clock at the post-transcriptional level.
26753996 2016 Regulation of transforming growth factor-beta1 (TGF-?1)-induced pro-fibrotic activities by circadian clock gene BMAL1.
26683776 2016 The circadian clock gene Bmal1 acts as a potential anti-oncogene in pancreatic cancer by activating the p53 tumor suppressor pathway.
26657859 2016 The chondrocyte clock gene Bmal1 controls cartilage homeostasis and integrity.
26562283 2015 A New Role Discovered for a Well-Known Clock Protein.
26507264 2015 Association of ARNTL and PER1 genes with Parkinson's disease: a case-control study of Han Chinese.
26283580 2015 Identification of circadian gene variants in bipolar disorder in Latino populations.
26247999 2015 Evidence for clock genes circadian rhythms in human full-term placenta.
26168277 2015 Acute Sleep Loss Induces Tissue-Specific Epigenetic and Transcriptional Alterations to Circadian Clock Genes in Men.
26164627 2015 Sumoylation controls CLOCK-BMAL1-mediated clock resetting via CBP recruitment in nuclear transcriptional foci.
26134245 2015 Association of CLOCK, ARNTL, and NPAS2 gene polymorphisms and seasonal variations in mood and behavior.
25936801 2015 Cancer/Testis Antigen PASD1 Silences the Circadian Clock.
25799324 2015 Depression-associated ARNTL and PER2 genetic variants in psychotic disorders.
25741730 2015 Cellular clocks in AVP neurons of the SCN are critical for interneuronal coupling regulating circadian behavior rhythm.
25480789 2015 Glucagon-CREB/CRTC2 signaling cascade regulates hepatic BMAL1 protein.
25416956 2014 A proteome-scale map of the human interactome network.
25352340 2014 Novel loci affecting iron homeostasis and their effects in individuals at risk for hemochromatosis.
25310406 2015 The peripheral clock regulates human pigmentation.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25203321 2014 A functional genomic approach identifies FAL1 as an oncogenic long noncoding RNA that associates with BMI1 and represses p21 expression in cancer.
25182847 2014 Nuclear envelope protein MAN1 regulates clock through BMAL1.
25175925 2014 Epigenetic silencing of ARNTL, a circadian gene and potential tumor suppressor in ovarian cancer.
25070164 2014 Expression of circadian rhythm genes CLOCK, BMAL1, and PER1 in buccal epithelial cells of patients with essential arterial hypertension in dependence on polymorphic variants of CLOCK and BMAL1 genes.
24728990 2014 The E3 ubiquitin ligase UBE3A is an integral component of the molecular circadian clock through regulating the BMAL1 transcription factor.
24636202 2014 Polymorphism of circadian clock genes and prophylactic lithium response.
24418196 2014 The rhythmic expression of clock genes attenuated in human plaque-derived vascular smooth muscle cells.
24385426 2014 Gene model 129 (Gm129) encodes a novel transcriptional repressor that modulates circadian gene expression.
24277452 2014 Overexpression of the circadian clock gene Bmal1 increases sensitivity to oxaliplatin in colorectal cancer.
24103761 2013 DNA methylation of the BMAL1 promoter.
24005054 2014 A meeting of two chronobiological systems: circadian proteins Period1 and BMAL1 modulate the human hair cycle clock.
23955654 2013 The clock gene brain and muscle Arnt-like protein-1 (BMAL1) is involved in hair growth.
23916625 2014 Molecular architecture of the mammalian circadian clock.
23785138 2013 p75 neurotrophin receptor is a clock gene that regulates oscillatory components of circadian and metabolic networks.
23606611 2013 Sex difference in daily rhythms of clock gene expression in the aged human cerebral cortex.
23584858 2013 Clock gene expression in the human pituitary gland.
23576606 2013 Mechanism of the circadian clock in physiology.
23563360 2013 Bmal1 suppresses cancer cell invasion by blocking the phosphoinositide 3-kinase-Akt-MMP-2 signaling pathway.
23546644 2013 Analysis of the molecular pathophysiology of sleep disorders relevant to a disturbed biological clock.
23449886 2013 Common genetic variants in ARNTL and NPAS2 and at chromosome 12p13 are associated with objectively measured sleep traits in the elderly.
23395176 2013 O-GlcNAc signaling entrains the circadian clock by inhibiting BMAL1/CLOCK ubiquitination.
23358160 2014 Genome-wide study of association and interaction with maternal cytomegalovirus infection suggests new schizophrenia loci.
23337503 2013 O-GlcNAcylation of BMAL1 regulates circadian rhythms in NIH3T3 fibroblasts.
23323702 2013 Circadian clock gene expression is impaired in gestational diabetes mellitus.
23303907 2013 Metabolism and the circadian clock converge.
23229515 2013 Intermolecular recognition revealed by the complex structure of human CLOCK-BMAL1 basic helix-loop-helix domains with E-box DNA.
23206673 2013 The major circadian pacemaker ARNT-like protein-1 (BMAL1) is associated with susceptibility to gestational diabetes mellitus.
23129285 Expression of the CLOCK, BMAL1, and PER1 circadian genes in human oral mucosa cells as dependent on CLOCK gene polymorphic variants.
23033538 2012 Circadian rhythms of glucocorticoid hormone actions in target tissues: potential clinical implications.
23003921 2012 CLOCK, PER2 and BMAL1 DNA methylation: association with obesity and metabolic syndrome characteristics and monounsaturated fat intake.
22990020 2012 Genome-wide association study for circulating levels of PAI-1 provides novel insights into its regulation.
22510946 2012 The circadian clock gene BMAL1 is a novel therapeutic target for malignant pleural mesothelioma.
22217103 2012 Comparison of ?-adrenergic and glucocorticoid signaling on clock gene and osteoblast-related gene expressions in human osteoblast.
22105622 2012 Adult attention-deficit hyperactivity disorder is associated with alterations in circadian rhythms at the behavioural, endocrine and molecular levels.
21990077 2011 The impact of sleep deprivation and nighttime light exposure on clock gene expression in humans.
21966465 2011 Deficient of a clock gene, brain and muscle Arnt-like protein-1 (BMAL1), induces dyslipidemia and ectopic fat formation.
21960634 2011 Histone lysine demethylase JARID1a activates CLOCK-BMAL1 and influences the circadian clock.
21799909 2011 Expression and rhythmic modulation of circulating microRNAs targeting the clock gene Bmal1 in mice.
21628546 2011 Modulation of clock gene expression by the transcriptional coregulator receptor interacting protein 140 (RIP140).
21411511 2011 Rhythmic diurnal gene expression in human adipose tissue from individuals who are lean, overweight, and type 2 diabetic.
21380491 2011 Expression of circadian genes correlates with liver metastasis and outcomes in colorectal cancer.
21363938 2011 A circadian clock entrained by melatonin is ticking in the rat fetal adrenal.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20861012 2010 The transcriptional repressor ID2 can interact with the canonical clock components CLOCK and BMAL1 and mediate inhibitory effects on mPer1 expression.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20554694 Circadian clock gene polymorphisms in alcohol use disorders and alcohol consumption.
20446921 2011 HSG cells, a model in the submandibular clock.
20368993 2010 ARNTL (BMAL1) and NPAS2 gene variants contribute to fertility and seasonality.
20222832 2010 The circadian rhythm of expression of Bmal1 and Cry1 in peripheral blood mononuclear cells of preterm neonates.
20180986 2010 CLOCK is suggested to associate with comorbid alcohol use and depressive disorders.
20174623 2010 Systematic analysis of circadian genes in a population-based sample reveals association of TIMELESS with depression and sleep disturbance.
20093779 2010 A promoter in the novel exon of hPPARgamma directs the circadian expression of PPARgamma.
20072116 2010 Differential association of circadian genes with mood disorders: CRY1 and NPAS2 are associated with unipolar major depression and CLOCK and VIP with bipolar disorder.
19934327 2009 Testing the circadian gene hypothesis in prostate cancer: a population-based case-control study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19912323 2010 Expression of clock genes Per1 and Bmal1 in total leukocytes in health and Parkinson's disease.
19861640 2010 Influence of age on clock gene expression in peripheral blood cells of healthy women.
19861541 2009 Epigenetic inactivation of the circadian clock gene BMAL1 in hematologic malignancies.
19839995 2009 Association study of 21 circadian genes with bipolar I disorder, schizoaffective disorder, and schizophrenia.
19693801 2010 PER2 variantion is associated with depression vulnerability.
19470168 2009 NPAS2 and PER2 are linked to risk factors of the metabolic syndrome.
19328558 2009 Case-control association study of 65 candidate genes revealed a possible association of a SNP of HTR5A to be a factor susceptible to bipolar disease in Bulgarian population.
19296127 2009 Disturbance of circadian gene expression in breast cancer.
19277210 2009 A large scale shRNA barcode screen identifies the circadian clock component ARNTL as putative regulator of the p53 tumor suppressor pathway.
18663240 2008 Genetic differences in human circadian clock genes among worldwide populations.
18587630 2008 CLOCK/BMAL1 regulates human nocturnin transcription through binding to the E-box of nocturnin promoter.
18517031 2008 Inter-individual differences in habitual sleep timing and entrained phase of endogenous circadian rhythms of BMAL1, PER2 and PER3 mRNA in human leukocytes.
18430226 2008 Interaction of circadian clock proteins PER2 and CRY with BMAL1 and CLOCK.
18411297 2008 DEC1 modulates the circadian phase of clock gene expression.
18228528 2008 Clock genes may influence bipolar disorder susceptibility and dysfunctional circadian rhythm.
17994337 2007 Activation of human period-1 by PKA or CLOCK/BMAL1 is conferred by separate signal transduction pathways.
17728404 2007 Aryl hydrocarbon receptor nuclear translocator-like (BMAL1) is associated with susceptibility to hypertension and type 2 diabetes.
17457720 2007 Three circadian clock genes Per2, Arntl, and Npas2 contribute to winter depression.
17274950 2007 Circadian expression of clock genes in human peripheral leukocytes.
16628007 2006 Post-translational regulation of circadian transcriptional CLOCK(NPAS2)/BMAL1 complex by CRYPTOCHROMES.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16528748 2006 Suggestive evidence for association of the circadian genes PERIOD3 and ARNTL with bipolar disorder.
16507006 2006 Association study of eight circadian genes with bipolar I disorder, schizoaffective disorder and schizophrenia.
16474406 2006 Feedback repression is required for mammalian circadian clock function.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14750904 2004 Phosphorylation of clock protein PER1 regulates its circadian degradation in normal human fibroblasts.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701734 2004 Identification of a novel basic helix-loop-helix-PAS factor, NXF, reveals a Sim2 competitive, positive regulatory role in dendritic-cytoskeleton modulator drebrin gene expression.
14701732 2004 Direct association between mouse PERIOD and CKIepsilon is critical for a functioning circadian clock.
14645221 2004 Histone acetyltransferase-dependent chromatin remodeling and the vascular clock.
12897057 2003 BMAL1-dependent circadian oscillation of nuclear CLOCK: posttranslational events induced by dimerization of transcriptional activators of the mammalian clock system.
12738229 2003 Regulation of the PAI-1 promoter by circadian clock components: differential activation by BMAL1 and BMAL2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12397359 2002 Dec1 and Dec2 are regulators of the mammalian molecular clock.
11875063 2002 The circadian regulatory proteins BMAL1 and cryptochromes are substrates of casein kinase Iepsilon.
11441146 2001 Regulation of clock and NPAS2 DNA binding by the redox state of NAD cofactors.
11439184 2001 Regulation of CLOCK and MOP4 by nuclear hormone receptors in the vasculature: a humoral mechanism to reset a peripheral clock.
10531061 1999 Light-independent role of CRY1 and CRY2 in the mammalian circadian clock.
9989497 1999 A molecular mechanism regulating rhythmic output from the suprachiasmatic circadian clock.
9704006 1998 Transcriptionally active heterodimer formation of an Arnt-like PAS protein, Arnt3, with HIF-1a, HLF, and clock.
9616112 1998 Role of the CLOCK protein in the mammalian circadian mechanism.
9576906 1998 The basic-helix-loop-helix-PAS orphan MOP3 forms transcriptionally active complexes with circadian and hypoxia factors.
9144434 1997 cDNA cloning and tissue-specific expression of a novel basic helix-loop-helix/PAS protein (BMAL1) and identification of alternatively spliced variants with alternative translation initiation site usage.
9079689 1997 Characterization of a subset of the basic-helix-loop-helix-PAS superfamily that interacts with components of the dioxin signaling pathway.