Property Summary

NCBI Gene PubMed Count 26
PubMed Score 53.03
PubTator Score 24.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -2.700 3.2e-07
medulloblastoma -1.500 1.3e-05
cystic fibrosis -1.478 3.4e-06
atypical teratoid / rhabdoid tumor -1.400 2.0e-03
glioblastoma -1.500 9.2e-04
medulloblastoma, large-cell -2.700 3.3e-04
lung cancer 1.100 1.2e-02
breast carcinoma 1.600 5.2e-04
pediatric high grade glioma -1.200 6.5e-04
nasopharyngeal carcinoma 1.100 9.6e-03
lung carcinoma 1.300 2.6e-18
Breast cancer 1.100 4.8e-03
ductal carcinoma in situ 1.300 1.8e-02
ovarian cancer -2.600 3.1e-08

Protein-protein Interaction (7)

Gene RIF (14)

PMID Text
25613063 Attenuated ARNT2 expression in HCC827 cells greatly promoted tumor growth.
24814368 Data suggest that selected human SIM1 (single-minded homolog 1) variants exhibit poor dimerization with ARNT2 and anomalous intracellular localization; these data were used to predict 'hot-spot' in SIM1/SIM2 (residues 290-326) critical for function.
24635660 nominal associations were found between autism spectrum disorder scores and single-nucleotide polymorphisms in OXT, ARNT2 and CD38
24465693 These results provide insight into the mechanisms of NPAS4/ARNT dimerisation and transcriptional activation.
24022475 mutation of ARNT2 results in absence of detectable levels of ARNT2 transcript and protein from patient fibroblasts compared with controls, consistent with nonsense-mediated decay of the mutant transcript and loss of ARNT2 function.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of aryl-hydrocarbon receptor nuclear translocator 2 (ARNT2) in peptide-treated PBMCs
21945317 ARNT2 might play an important role in the modulation of HIF-1-regulated signaling and metabolism.
21512513 In white males, rs4072568 in ARNT2 was also associated with BMI (P = 9 x 10(-4)) and % body fat (P = 0.001).
20706985 promotes differentiation of IL-22-producing CD4(+) T-cells
20634891 Observational study of gene-disease association. (HuGE Navigator)
19598235 Observational study of gene-disease association. (HuGE Navigator)
17899366 a possible use of ARNT2 and GST A1 as prognostic breast cancer biomarkers.
17826745 We thus propose that NDN regulates neuronal function and hypoxic response by regulating the activities of the ARNT2:SIM1 and ARNT2:HIF1alpha dimers, respectively.
12210012 There is no association of ARNT2 gene with cleft palate only (n = 45) and cleft lip/palate (n = 37).

AA Sequence

MATPAAVNPPEMASDIPGSVTLPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGPSKFSRENHSE      1 - 70
IERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTGNKSTDGAYKPSFLTEQELKH     71 - 140
LILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFGSTLYEQVHPDDVEKLREQLCTSENSMTGRI    141 - 210
LDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGNAPLDHLPLNRITTMRKRFRNGLGPVKEGEAQYAVV    211 - 280
HCTGYIKAWPPAGMTIPEEDADVGQGSKYCLVAIGRLQVTSSPVCMDMNGMSVPTEFLSRHNSDGIITFV    281 - 350
DPRCISVIGYQPQDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTF    351 - 420
QNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSVEKADAIFSQE    421 - 490
RDPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGSPFPSGHSGKAFSSSVVHVPGVNDIQSSSSTGQNM    491 - 560
SQISRQLNQSQVAWTGSRPPFPGQQIPSQSSKTQSSPFGIGTSHTYPADPSSYSPLSSPATSSPSGNAYS    561 - 630
SLANRTPGFAESGQSSGQFQGRPSEVWSQWQSQHHGQQSGEQHSHQQPGQTEVFQDMLPMPGDPTQGTGN    631 - 700
YNIEDFADLGMFPPFSE                                                         701 - 717
//

Text Mined References (29)

PMID Year Title
25613063 2015 ARNT2 is downregulated and serves as a potential tumor suppressor gene in non-small cell lung cancer.
24814368 2014 Characterization of human variants in obesity-related SIM1 protein identifies a hot-spot for dimerization with the partner protein ARNT2.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24635660 2014 Associations between oxytocin-related genes and autistic-like traits.
24465693 2014 Human variants in the neuronal basic helix-loop-helix/Per-Arnt-Sim (bHLH/PAS) transcription factor complex NPAS4/ARNT2 disrupt function.
24022475 2013 ARNT2 mutation causes hypopituitarism, post-natal microcephaly, visual and renal anomalies.
21945317 2011 siRNA-mediated knockdown of aryl hydrocarbon receptor nuclear translocator 2 affects hypoxia-inducible factor-1 regulatory signaling and metabolism in human breast cancer cells.
21512513 2011 Replication and extension of association between common genetic variants in SIM1 and human adiposity.
20706985 2010 Activation of the aryl hydrocarbon receptor reveals distinct requirements for IL-22 and IL-17 production by human T helper cells.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
19598235 2009 Genes related to sex steroids, neural growth, and social-emotional behavior are associated with autistic traits, empathy, and Asperger syndrome.
18711365 2008 Collaborative genome-wide association analysis supports a role for ANK3 and CACNA1C in bipolar disorder.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17899366 2008 Drug metabolism-related genes as potential biomarkers: analysis of expression in normal and tumour breast tissue.
17826745 2007 Separate necdin domains bind ARNT2 and HIF1alpha and repress transcription.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12239177 2002 Hypoxia-inducible erythropoietin gene expression in human neuroblastoma cells.
12210012 2002 Aryl hydrocarbon receptor nuclear translocator 2 (ARNT2): structure, gene mapping, polymorphisms, and candidate evaluation for human orofacial clefts.
11782478 2002 Differential activities of murine single minded 1 (SIM1) and SIM2 on a hypoxic response element. Cross-talk between basic helix-loop-helix/per-Arnt-Sim homology transcription factors.
11247670 2001 Identification of mesoderm development (mesd) candidate genes by comparative mapping and genome sequence analysis.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10648817 2000 Different transcriptional properties of mSim-1 and mSim-2.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.