Property Summary

NCBI Gene PubMed Count 143
PubMed Score 243.26
PubTator Score 314.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -1.800 5.7e-07
psoriasis -1.500 8.7e-04
osteosarcoma -3.011 5.8e-08
atypical teratoid / rhabdoid tumor 1.200 9.7e-07
glioblastoma 1.100 2.6e-04
medulloblastoma, large-cell 1.400 7.1e-06
intraductal papillary-mucinous adenoma (... 1.100 5.8e-03
ovarian cancer -1.700 2.2e-08

Protein-protein Interaction (8)

Gene RIF (97)

PMID Text
26572229 The results of this study indicate that ARNT depletion renders tumour cells susceptible to radiation whereas overexpression of this transcription factor confers radioresistance
26469385 HIV-1 MA downregulates ARNT gene expression in HepG2 cells
26388611 HIF-1beta might act as a novel cross-link between the HIF and NF-kappaB pathways in suppression of angiogenesis by LDL, while proteasome inhibitors might promote angiogenesis by reactivating this signaling cascade under hyperlipidemia.
26101050 ARNT Val189Val polymorphism is not associated with endometriosis in Asians.
25904334 HIF1 regulates claudin-1 in intestinal epithelium. This regulation is important for intestinal epithelial tight junction integrity.
25839165 Down-regulation of ARNT promotes colorectal cancer metastasis by activating the fibronectin/integrin beta1/FAK axis.
25769544 AhR/ARNT activation and overexpression of BCL6 are collectively responsible for differential expression of more than 100 genes in diffuse large B-cell lymphoma cell line.
25627682 findings suggest that TACC3 could be recruited as a bridge to cooperatively mediate between the HIF-2alpha PAS-B.ARNT PAS-B complex, thereby participating more directly in HIF-dependent gene transcription than previously anticipated
25343232 ARNT expression in the placental vasculature mediates key angiogenic expression and fetoplacental endothalial cell angiogenesis, and low ARNT expression in FGRadv ECs appears to be a key factor in deficient angiogenesis.
25201625 Arnt suppressed CXCL8, but did not prevent the p65-activation directly.
25068796 Data indicate that silencing of hypoxia-inducible factor-1 beta (HIF-1beta) sensitizes tumor cells to hypoxic apoptosis.
24990649 Myeloid ARNT is important for innate immune function and wound healing.
24921657 knockdown of ARNT in cancer cells reduced the proliferation rate and the transformation ability of those cells.
24849811 The objective of this review is therefore to highlight and summarize current knowledge regarding the hypoxia-dependent upregulation of ARNT
24726500 Resveratrol inhibited NHEK proliferation by downregulating the expression of AQP3 in an SIRT1/ARNT/ERK dependent fashion.
24664708 Here we discuss recent findings from our lab and others that define roles of the HIF-VEGF axis in the retina.
24618291 We demonstrate that Arnt is an interaction partner for Miz-1, and that Arnt has a functional role in the regulation of CDKN2B
24371328 These findings highlight the importance of the hypoxia-sensing pathway and HIFs in clinical hematology.
24249660 ARNT gene deletion is associated with chronic lymphocytic leukemia.
24220583 ARNT may modulate reactive oxygen species signaling and drug response in acute myeloid leukemia.
23907215 ARNT was found to be responsible for establishing the drug-resistant properties of cancer cells by upregulation of MDR1.
23541582 Among a panel of five different cell lines, in 518A2 cells exposed to hypoxia-mimetic cobalt chloride, HIF-1beta is rapidly elevated on protein level.
23448877 In loco synthesis of these highly potent AhR inducers by Malassezia yeasts could have a significant impact on skin homeostatic mechanisms and disease development.
23116263 Understanding the DNA binding-independent functions of ARNT may identify novel therapeutic options for the treatment of a large spectrum of disease states.
22903824 Study identifies AHR/ARNT cobound regions across the genome.
22505606 ARNT controls AREG expression and the downstream EGFR-ERK pathway in keratinocytes, at least in part, by modulating HDAC activity.
22387692 miR-24 negatively regulates ARNT expression in human liver, affecting the expression of its downstream genes. miR-24 would be one of the factors underlying the mechanisms by which ARNT protein is decreased by reactive oxygen species
22328528 Binding of the ERalpha and ARNT1 AF2 domains to exon 21 of the SRC1 isoform SRC1e is essential for estrogen- and dioxin-transcription.
22306343 Ainp1 reduces the interaction between ARNT and HIF-1alpha, suppresses the formation of the HIF-1 gel shift complex, and suppresses the ARNT recruitment to the vegf promoter.
22235307 the specific functions of AHR and ARNT in estrogen-dependent signaling
22211302 results suggest that polymorphism located in the promoter of the AHR gene is associated with a protective effect on vitiligo in Han Chinese populations
22183315 ARNT may regulate many processes relevant to the biology of age related macular degeneration.
21828933 The presence of five unique SNPs at the ARNT locus are shown.
21742528 The homozygote variant genotype of AHR Lys554Lys is associated with a significantly lower AHR, ARNT and CYP1B1 mRNA expression.
21544813 Data show that ARNT is an important regulator of hepatocellular carcinoma (HCC) growth and metastasis and could be a promising prognostic candidate in HCC patients.
21512126 mutations on ARNT PAS-B modulate coactivator selectivity and target gene induction by HIF in vivo, demonstrating a bifunctional role for transcriptional regulation by PAS domains within bHLH-PAS transcription factors
21462134 No association between AhR 1661G/A and ARNT 567G/C genetic polymorphisms and endometriosis was found in the southern Han Chinese women in this study.
21435239 results show that ER-beta suppresses HIF-1alpha-mediated transcription via aryl hydrocarbon receptor nuclear translocator (ARNT) downregulation, which may account for the tumour suppressive function of ER-beta
21298084 NF-kB controls the levels of HIF-1a and HIF-1b genes by direct regulation.
21199896 Cloning and functional analysis of the HIF-1beta promoter identifies a prominent region for interferon (IFN)-gamma-dependent repression.
21081473 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20804916 Reverse transcriptase-polymerase chain reaction analysis disclosed the existence of a ETV6-ARNT fusion gene in a patient with childhood T lymphoblastic leukemia.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20508969 These results reveal a novel mechanism by which ARNT acts as a modulator to bridge the c-Jun/Sp1 interaction and plays a role in EGF-mediated gene expression under normoxic conditions.
20478051 the expression of miR-101 is also modulated at different physiological conditions, such as androgen stimulation and HIF-1alpha/HIF-1beta induction.
20453000 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19850893 the expression of ARNT protein is significantly reduced in aryl hydrocarbon receptor interacting protein mutation+ tumors
19828131 HIF-1beta availability determines ABCA1 expression and cholesterol efflux in macrophages under hypoxia and may contribute to the interpersonal variability of atherosclerotic lesion progression.
19730683 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19416713 A deficiency of ARNT action in the liver could contribute to the altered metabolic function in humans with type 2 diabetes.
19287200 The results of the present study demonstrate that HIF-1alpha and HIF-1beta enhances expression of VEGF and glucose metabolism-related genes in response to hypoxia in gastric cancer.
19251700 The SUMOylation of both AhRR and Arnt is important for the efficient transcriptional repression activity of the AhRR/Arnt heterodimer
19203995 ARNT plays an important role in EGF-regulated COX-2 gene expression and may thus be related to either a cause or a consequence of tumorigenesis in cervical cancer
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19131627 identification of ARNT as a CD30-interacting protein that modulated the activity of the RelB subunit of the transcription factor NF-kappaB; findings indicate that ARNT functions in concert with RelB in a CD30-induced negative feedback mechanism
19129502 crystal structures of the heterodimer formed by the C-terminal PAS domains from the HIF2alpha and ARNT subunits of the HIF2 transcription factor, both in the absence and presence of an artificial ligand.
19030229 subtypes of VHL mutations support an intermediate level of HIF-1alpha and HIF-2alpha regulation via a remnant VBC complex.
19018768 Curcumin attenuates cytochrome P450 induction in response to TCDD by ROS-dependently degrading AhR and ARNT.
18949049 Hybrids of the bHLH and bZIP protein motifs display different DNA-binding activities in vivo vs. in vitro.
18762723 reduced availability of glucose under hypoxia downregulates HIF-1 in part through the inhibition of HIF-1 alpha mRNA
18676680 Observational study of gene-disease association. (HuGE Navigator)
18632753 Observational study of gene-disease association. (HuGE Navigator)
18568448 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18381358 The downregulation of ETS1 expression with small interfering RNA (siRNA) involves HIF1beta in regulating hypoxia-inducible genes.
18375543 identified hypoxia inducible factor 1beta (HIF1beta) as a TG2 binding partner
18366646 ARNT variants are unlikely to explain the linkage signal on chromosome 1q, but may alter insulin secretion in nondiabetic subjects
18366646 Observational study of gene-disease association. (HuGE Navigator)
18174159 Overexpression of presenilin-1 increased HIF-1beta, suggesting that HIF is downstream of presenilin
17559847 Observational study of gene-disease association. (HuGE Navigator)
17559847 Allele and genotype frequencies of AHR and ARNT polymorphisms were similar between infertile men and controls.
16567799 xenobiotic (TCDD) treatments of breast cancer cells containing reduced levels of BRCA1 cause the transcription factor ARNT to become unstable
16554418 In hypoxia, HIF-alpha is stabilized and either dimerizes with HIF-beta to form transcriptionally active HIF for a hypoxia response, or it interacts with unrelated proteins, enabling convergence of HIF oxygen sensing with other signaling pathways.
16520375 for the bHLH.PAS transcription factors Dioxin Receptor and Arnt, the DR PAS A domain has a role in dimerization and affinity for an atypical E-box DNA sequence
16410262 dioxin receptor is silenced by promoter hypermethylation in human acute lymphoblastic leukemia through inhibition of Sp1 binding
16364012 Observational study of gene-disease association. (HuGE Navigator)
16364012 In our cohort of patients, the polymorphism in codon 511 of the ARNT gene is not associated with RM.
16129408 Phosphorylation of Ser77 within the alternative exon of ARNT has a major influence on the activity of alternatively (Alt) spliced ARNT homodimers, but not an Alt ARNT heterodimer.
16111650 Ainp2 enhances the 3-methylchloranthrene-induced activity in HepG2 cells, suggesting that Ainp2 plays a role in the Arnt-dependent function.
16096055 The role of ARNT/HIF1beta and altered gene expression in impaired beta cell function and the pathogenesis of human type 2 diabetes.
16084889 Observational study of gene-disease association. (HuGE Navigator)
16007214 Stat3 is required for both basal and growth signal-induced expression of HIF-1
15837795 ER alpha-AHR-ARNT protein-protein interactions mediate estradiol-dependent transrepression of dioxin-inducible gene transcription
15492120 Studies using a small interfering RNA to down-regulate Arnt protein expression revealed that TCDD-induced G(1) arrest is absolutely dependent on the Arnt protein.
15190133 nucleotide preference of the heterodimers of HLF and Arnt, and of AHR and Arnt
14638687 formation of stable protein-DNA complexes by DR/Arnt and HIF-1alpha/Arnt heterodimers with their cognate DNA sequences requires Per/Arnt/Sim A domains
12774124 estrogen receptor-mediated estrogen signalling is modulated by a co-regulatory-like function of activated AhR/Arnt, giving rise to adverse oestrogen-related actions of dioxin-type environmental contaminants
12754377 function as potent coactivator of estrogen receptor-dependent transcription
12586752 experiments revealed a complex distribution of aryl hydrocarbon receptor and aryl hydrocarbon receptor nuclear translocator mRNAs and proteins in rat and human testis
12354770 modification by SUMO-1 chiefly at Lys(245) within the PAS domain of this protein, both in vivo and in vitro
12024042 SRC-1, NCoA-2, and p/CIP are capable of independently enhancing TCDD-dependent induction of a luciferase reporter gene by the AHR/ARNT dimer
11835227 Observational study of gene-disease association. (HuGE Navigator)
11756572 The female reproductive tract expresses AHR and ARNT mRNA, and changes in expression at target sites in conditions such as endometriosis and uterine leiomyomas suggest a potential role for these factors in the pathogenesis of these conditions.
11393538 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSND      1 - 70
KERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMK     71 - 140
SLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLY    141 - 210
DQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSVN    211 - 280
RLSFVRNRCRNGLGSVKDGEPHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPN    281 - 350
CTDMSNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKG    351 - 420
QVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQRPQLGPTANL    421 - 490
PLEMGSGQLAPRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSKPLEKSDGLFAQDRDPRFSEI    491 - 560
YHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENFRNSGLAPPVTIVQPSASAGQMLAQISRHSN    561 - 630
PTQGATPTWTPTTRSGFSAQQVATQATAKTRTSQFGVGSFQTPSSFSSMSLPGAPTASPGAAAYPSLTNR    631 - 700
GSNFAPETGQTAGQFQTRTAEGVGVWPQWQGQQPHHRSSSSEQHVQQPPAQQPGQPEVFQEMLSMLGDQS    701 - 770
NSYNNEEFPDLTMFPPFSE                                                       771 - 789
//

Text Mined References (150)

PMID Year Title
26572229 2015 The expression level of the transcription factor Aryl hydrocarbon receptor nuclear translocator (ARNT) determines cellular survival after radiation treatment.
26388611 2015 LDL suppresses angiogenesis through disruption of the HIF pathway via NF-?B inhibition which is reversed by the proteasome inhibitor BSc2118.
26101050 2015 Meta-analysis of the association of AhR Arg554Lys, AhRR Pro185Ala, and ARNT Val189Val polymorphisms and endometriosis risk in Asians.
25904334 2015 HIF-dependent regulation of claudin-1 is central to intestinal epithelial tight junction integrity.
25839165 2015 Down-regulation of ARNT promotes cancer metastasis by activating the fibronectin/integrin ?1/FAK axis.
25769544 2015 BCL6--regulated by AhR/ARNT and wild-type MEF2B--drives expression of germinal center markers MYBL1 and LMO2.
25627682 2015 Coiled-coil coactivators play a structural role mediating interactions in hypoxia-inducible factor heterodimerization.
25343232 2015 Impaired fetoplacental angiogenesis in growth-restricted fetuses with abnormal umbilical artery doppler velocimetry is mediated by aryl hydrocarbon receptor nuclear translocator (ARNT).
25201625 2014 AhR and Arnt differentially regulate NF-?B signaling and chemokine responses in human bronchial epithelial cells.
25068796 2014 Silencing of hypoxia-inducible factor-1? induces anti-tumor effects in hepatoma cell lines under tumor hypoxia.
24990649 2014 Reduction of ARNT in myeloid cells causes immune suppression and delayed wound healing.
24921657 2014 An increase in reactive oxygen species by deregulation of ARNT enhances chemotherapeutic drug-induced cancer cell death.
24849811 2014 Hypoxia-inducible aryl hydrocarbon receptor nuclear translocator (ARNT) (HIF-1?): is it a rare exception?
24726500 2014 Resveratrol inhibition of human keratinocyte proliferation via SIRT1/ARNT/ERK dependent downregulation of aquaporin 3.
24664708 2014 Hypoxia-inducible factor (HIF)/vascular endothelial growth factor (VEGF) signaling in the retina.
24618291 2014 Regulation of CDKN2B expression by interaction of Arnt with Miz-1--a basis for functional integration between the HIF and Myc gene regulatory pathways.
24434214 2014 Cbx4 governs HIF-1? to potentiate angiogenesis of hepatocellular carcinoma by its SUMO E3 ligase activity.
24371328 2014 Targeting the hypoxia-sensing pathway in clinical hematology.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24249660 2014 Chronic lymphocytic leukemia in a child: a challenging diagnosis in pediatric oncology practice.
24220583 2013 The aryl hydrocarbon receptor nuclear translocator (ARNT) modulates the antioxidant response in AML cells.
23907215 2013 Expression of aryl hydrocarbon receptor nuclear translocator enhances cisplatin resistance by upregulating MDR1 expression in cancer cells.
23585552 2013 Genome-wide association study identifies genetic risk underlying primary rhegmatogenous retinal detachment.
23541582 2013 Hypoxia-inducible factor-1? (HIF-1?) is upregulated in a HIF-1?-dependent manner in 518A2 human melanoma cells under hypoxic conditions.
23448877 2013 Malassezia yeasts produce a collection of exceptionally potent activators of the Ah (dioxin) receptor detected in diseased human skin.
23275542 2013 2,3,7,8-Tetrachlorodibenzo-p-dioxin poly(ADP-ribose) polymerase (TiPARP, ARTD14) is a mono-ADP-ribosyltransferase and repressor of aryl hydrocarbon receptor transactivation.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23116263 2013 The aryl hydrocarbon receptor nuclear translocator (ARNT) family of proteins: transcriptional modifiers with multi-functional protein interfaces.
22903824 2012 High-resolution genome-wide mapping of AHR and ARNT binding sites by ChIP-Seq.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22505606 2012 ARNT controls the expression of epidermal differentiation genes through HDAC- and EGFR-dependent pathways.
22387692 2012 Aryl hydrocarbon receptor nuclear translocator in human liver is regulated by miR-24.
22328528 2012 Binding of the ER? and ARNT1 AF2 domains to exon 21 of the SRC1 isoform SRC1e is essential for estrogen- and dioxin-related transcription.
22306343 2012 Suppression of the hypoxia inducible factor-1 function by redistributing the aryl hydrocarbon receptor nuclear translocator from nucleus to cytoplasm.
22235307 2012 Distinct roles for aryl hydrocarbon receptor nuclear translocator and ah receptor in estrogen-mediated signaling in human cancer cell lines.
22211302 2012 The association of functional polymorphisms in the aryl hydrocarbon receptor (AHR) gene with the risk of vitiligo in Han Chinese populations.
22183315 2012 Exploring the potential role of the oxidant-activated transcription factor aryl hydrocarbon receptor in the pathogenesis of AMD.
21983785 2011 Genome-wide association study identifies a new melanoma susceptibility locus at 1q21.3.
21828933 2011 Single nucleotide polymorphisms in the human aryl hydrocarbon receptor nuclear translocator (ARNT) gene.
21742528 RNA expressions of AHR, ARNT and CYP1B1 are influenced by AHR Arg554Lys polymorphism.
21620138 2011 Pyruvate kinase M2 is a PHD3-stimulated coactivator for hypoxia-inducible factor 1.
21544813 2012 Aryl hydrocarbon receptor nuclear translocator is associated with tumor growth and progression of hepatocellular carcinoma.
21512126 2011 Coactivators necessary for transcriptional output of the hypoxia inducible factor, HIF, are directly recruited by ARNT PAS-B.
21462134 2011 [No association of AhR gene 1661G/A and ARNT gene 567G/C polymorphisms with endometriosis in southern Han Chinese women].
21435239 2011 Estrogen receptor beta inhibits transcriptional activity of hypoxia inducible factor-1 through the downregulation of arylhydrocarbon receptor nuclear translocator.
21298084 2011 Evolutionary conserved regulation of HIF-1? by NF-?B.
21199896 2011 IFN-? attenuates hypoxia-inducible factor (HIF) activity in intestinal epithelial cells through transcriptional repression of HIF-1?.
21081473 2011 Genetic variation in the bioactivation pathway for polycyclic hydrocarbons and heterocyclic amines in relation to risk of colorectal neoplasia.
20932347 2010 Increased accumulation of hypoxia-inducible factor-1? with reduced transcriptional activity mediates the antitumor effect of triptolide.
20804916 2010 ETV6-ARNT fusion in a patient with childhood T lymphoblastic leukemia.
20699359 2010 Casein kinase 1 regulates human hypoxia-inducible factor HIF-1.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20603618 2010 RKTG inhibits angiogenesis by suppressing MAPK-mediated autocrine VEGF signaling and is downregulated in clear-cell renal cell carcinoma.
20562859 2010 Network organization of the human autophagy system.
20508969 2010 Involvement of aryl hydrocarbon receptor nuclear translocator in EGF-induced c-Jun/Sp1-mediated gene expression.
20478051 2010 MicroRNA-101 negatively regulates Ezh2 and its expression is modulated by androgen receptor and HIF-1alpha/HIF-1beta.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19850893 2009 The expression of AIP-related molecules in elucidation of cellular pathways in pituitary adenomas.
19828131 2010 HIF-1beta determines ABCA1 expression under hypoxia in human macrophages.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19416713 2009 Ablation of ARNT/HIF1beta in liver alters gluconeogenesis, lipogenic gene expression, and serum ketones.
19287200 2009 Regulation of glucose metabolism-related genes and VEGF by HIF-1alpha and HIF-1beta, but not HIF-2alpha, in gastric cancer.
19251700 2009 SUMO modification regulates the transcriptional repressor function of aryl hydrocarbon receptor repressor.
19203995 2009 Epidermal growth factor-activated aryl hydrocarbon receptor nuclear translocator/HIF-1{beta} signal pathway up-regulates cyclooxygenase-2 gene expression associated with squamous cell carcinoma.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19131627 2009 The aryl hydrocarbon nuclear translocator alters CD30-mediated NF-kappaB-dependent transcription.
19129502 2009 Artificial ligand binding within the HIF2alpha PAS-B domain of the HIF2 transcription factor.
19030229 2008 VHL type 2B mutations retain VBC complex form and function.
19018768 2008 Curcumin attenuates cytochrome P450 induction in response to 2,3,7,8-tetrachlorodibenzo-p-dioxin by ROS-dependently degrading AhR and ARNT.
18949049 2008 Hybrids of the bHLH and bZIP protein motifs display different DNA-binding activities in vivo vs. in vitro.
18762723 2008 Regulation of hypoxia-inducible factor 1 by glucose availability under hypoxic conditions.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18632753 2008 Bladder cancer risk and genetic variation in AKR1C3 and other metabolizing genes.
18568448 2008 Calbindin 1, fibroblast growth factor 20, and alpha-synuclein in sporadic Parkinson's disease.
18381358 2008 Regulation of hypoxia-inducible genes by ETS1 transcription factor.
18375543 2008 Transglutaminase 2 protects against ischemic insult, interacts with HIF1beta, and attenuates HIF1 signaling.
18366646 2008 Aryl hydrocarbon receptor nuclear translocator (ARNT) gene as a positional and functional candidate for type 2 diabetes and prediabetic intermediate traits: Mutation detection, case-control studies, and gene expression analysis.
18174159 2008 Glucose and endoplasmic reticulum calcium channels regulate HIF-1beta via presenilin in pancreatic beta-cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17559847 2007 The contribution of genetic variations of aryl hydrocarbon receptor pathway genes to male factor infertility.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16567799 2006 BRCA1 modulates xenobiotic stress-inducible gene expression by interacting with ARNT in human breast cancer cells.
16554418 2006 Hypoxia-inducible factors in the kidney.
16520375 2006 Novel DNA binding by a basic helix-loop-helix protein. The role of the dioxin receptor PAS domain.
16410262 2006 The dioxin receptor is silenced by promoter hypermethylation in human acute lymphoblastic leukemia through inhibition of Sp1 binding.
16364012 2006 The aryl hydrocarbon receptor nuclear translocator gene polymorphism in patients with recurrent miscarriage.
16129408 2005 Phosphorylation inhibits DNA-binding of alternatively spliced aryl hydrocarbon receptor nuclear translocator.
16111650 2005 A novel Arnt-interacting protein Ainp2 enhances the aryl hydrocarbon receptor signalling.
16096055 2005 Loss of ARNT/HIF1beta mediates altered gene expression and pancreatic-islet dysfunction in human type 2 diabetes.
16084889 2005 Analysis of the AhR, ARNT, and AhRR gene polymorphisms: genetic contribution to endometriosis susceptibility and severity.
16007214 2005 Targeting Stat3 blocks both HIF-1 and VEGF expression induced by multiple oncogenic growth signaling pathways.
15837795 2005 ER alpha-AHR-ARNT protein-protein interactions mediate estradiol-dependent transrepression of dioxin-inducible gene transcription.
15492120 2005 Multiple mechanisms are involved in Ah receptor-mediated cell cycle arrest.
15485806 2004 Recruitment of thyroid hormone receptor/retinoblastoma-interacting protein 230 by the aryl hydrocarbon receptor nuclear translocator is required for the transcriptional response to both dioxin and hypoxia.
15368494 2004 Significant association between nonsyndromic oral clefts and arylhydrocarbon receptor nuclear translocator (ARNT).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15190133 2004 Altered DNA binding specificity of Arnt by selection of partner bHLH-PAS proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701734 2004 Identification of a novel basic helix-loop-helix-PAS factor, NXF, reveals a Sim2 competitive, positive regulatory role in dendritic-cytoskeleton modulator drebrin gene expression.
14638687 2004 Contribution of the Per/Arnt/Sim (PAS) domains to DNA binding by the basic helix-loop-helix PAS transcriptional regulators.
12774124 2003 Modulation of oestrogen receptor signalling by association with the activated dioxin receptor.
12754377 2003 The basic helix-loop-helix-PAS protein ARNT functions as a potent coactivator of estrogen receptor-dependent transcription.
12586752 2003 Expression of aryl hydrocarbon receptor and aryl hydrocarbon receptor nuclear translocator messenger ribonucleic acids and proteins in rat and human testis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12354770 2002 The aryl hydrocarbon receptor nuclear transporter is modulated by the SUMO-1 conjugation system.
12032587 2002 Variability of the human aryl hydrocarbon receptor nuclear translocator (ARNT) gene.
12024042 2002 Recruitment of the NCoA/SRC-1/p160 family of transcriptional coactivators by the aryl hydrocarbon receptor/aryl hydrocarbon receptor nuclear translocator complex.
11879970 2002 The p23 co-chaperone facilitates dioxin receptor signaling in a yeast model system.
11835227 2002 Characterization of the aryl hydrocarbon receptor repressor gene and association of its Pro185Ala polymorphism with micropenis.
11782478 2002 Differential activities of murine single minded 1 (SIM1) and SIM2 on a hypoxic response element. Cross-talk between basic helix-loop-helix/per-Arnt-Sim homology transcription factors.
11768231 2001 Aryl hydrocarbon receptor/dioxin receptor in human monocytes and macrophages.
11756572 2002 Uterine and ovarian aryl hydrocarbon receptor (AHR) and aryl hydrocarbon receptor nuclear translocator (ARNT) mRNA expression in benign and malignant gynaecological conditions.
11502749 2001 The basic helix-loop-helix domain of the aryl hydrocarbon receptor nuclear transporter (ARNT) can oligomerize and bind E-box DNA specifically.
11393538 2001 Human arylhydrocarbon receptor repressor (AHRR) gene: genomic structure and analysis of polymorphism in endometriosis.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11129342 2000 Genomic structure of the human Ah receptor nuclear translocator gene (hARNT).
10999956 2000 Aryl hydrocarbon receptor is required for p300-mediated induction of DNA synthesis by adenovirus E1A.
10829078 2000 The t(1;12)(q21;p13) translocation of human acute myeloblastic leukemia results in a TEL-ARNT fusion.
10777486 2000 Role of hypoxia-inducible factor-1 in transcriptional activation of ceruloplasmin by iron deficiency.
10692439 2000 Cardiovascular basic helix loop helix factor 1, a novel transcriptional repressor expressed preferentially in the developing and adult cardiovascular system.
10395741 1999 Interactions of nuclear receptor coactivator/corepressor proteins with the aryl hydrocarbon receptor complex.
9887096 1999 Identification of a novel mechanism of regulation of Ah (dioxin) receptor function.
9328285 1997 Aryl hydrocarbon (Ah) nonresponsiveness in estrogen receptor-negative MDA-MB-231 cells is associated with expression of a variant arnt protein.
9271372 1997 The murine Sim-2 gene product inhibits transcription by active repression and functional interference.
9111057 1997 Ligand-dependent interaction of the aryl hydrocarbon receptor with a novel immunophilin homolog in vivo.
9079689 1997 Characterization of a subset of the basic-helix-loop-helix-PAS superfamily that interacts with components of the dioxin signaling pathway.
9020169 1997 Two murine homologs of the Drosophila single-minded protein that interact with the mouse aryl hydrocarbon receptor nuclear translocator protein.
8940186 1996 Mapping the protein/DNA contact sites of the Ah receptor and Ah receptor nuclear translocator.
8927054 1996 Two new members of the murine Sim gene family are transcriptional repressors and show different expression patterns during mouse embryogenesis.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8794892 1996 Trans-activation by the human aryl hydrocarbon receptor and aryl hydrocarbon receptor nuclear translocator proteins: direct interactions with basal transcription factors.
8756616 1996 Activation of vascular endothelial growth factor gene transcription by hypoxia-inducible factor 1.
8621524 1996 Functional characterization of DNA-binding domains of the subunits of the heterodimeric aryl hydrocarbon receptor complex imputing novel and canonical basic helix-loop-helix protein-DNA interactions.
8384309 1993 Ligand-dependent recruitment of the Arnt coregulator determines DNA recognition by the dioxin receptor.
8244375 1993 The Ah receptor nuclear translocator gene (ARNT) is located on q21 of human chromosome 1 and on mouse chromosome 3 near Cf-3.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8065341 1994 Identification of functional domains of the aryl hydrocarbon receptor nuclear translocator protein (ARNT).
7716743 1994 Immunohistochemical double-staining for Ah receptor and ARNT in human embryonic palatal shelves.
7628454 1995 Protein-protein interaction via PAS domains: role of the PAS domain in positive and negative regulation of the bHLH/PAS dioxin receptor-Arnt transcription factor complex.
7539918 1995 Hypoxia-inducible factor 1 is a basic-helix-loop-helix-PAS heterodimer regulated by cellular O2 tension.
7488247 1995 Functional analysis of aryl hydrocarbon receptor nuclear translocator interactions with aryl hydrocarbon receptor in the yeast two-hybrid system.
1852076 1991 Cloning of a factor required for activity of the Ah (dioxin) receptor.
1317062 1992 Identification of the Ah receptor nuclear translocator protein (Arnt) as a component of the DNA binding form of the Ah receptor.