Property Summary

NCBI Gene PubMed Count 187
PubMed Score 217.69
PubTator Score 175.63

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P0C7Q2 B2Y7I5
Symbols ARMD8

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (213)

PMID Text
26427389 Studies indicate that the high-risk allele of the 10q26 locus encompasses three genes, PLEKHA1, ARMS2, and HTRA1 with high linkage disequilibrium.
26337002 The growth of choroidal neovascularization in AMD would be affected by 2 genes: MMP20, a newly confirmed gene expressed in the retina, and ARMS2/HTRA1, a well-known susceptibility gene for AMD.
26275133 GRS using ARMS2, CFH, TNFRSF10A, VEGFA, and CFI was significantly associated with second-eye involvement. Genetic risk has high predictive ability for second-eye involvement of AMD.
26132079 No significant interaction was found between DHA supplementation benefit and ARMS2 A69S SNP.
25792034 results suggest that calcium, ARMS2 genotype, C. pneumonia infection, and age are significant factors in the development of the early stages of AMD.
25786237 Determined the differential effects of genetic polymorphism in CFH and ARMS2 on risk of age-related macular degeneration (AMD)
25771815 In this study, we found that the interaction of ARMS2 and ARMS2/HTRA1 is significantly associated with nAMD, and the interaction of CFH and ARMS2 is pronounced in PCV development in Chinese population.
25715554 There is association of ARMS2 gene polymorphism with different subtypes of Age-related macular degeneration
25695752 Patients carrying 4 risk alleles in CFH and ARMS2 developed neovascular AMD 12.2 (95% CI, 6.2-18.3) years earlier than patients with zero risk alleles (P < .001).
25519903 HTRA1 gene is transcriptionally regulated by insertion/deletion nucleotides located at the 3' end of the ARMS2 gene in patients with age-related macular degeneration.
25439433 Chronic chronic central serous chorioretinopathy (CSC) is associated with genetic variants in ARMS2 and CFH, indicating a genetic and pathophysiologic overlap between cCSC and age-related macular degeneration.
25205867 A total of 12 weeks of exposure to mainstream cigarette smoke led to CNV rates of 7.7% for wild type (Wt) mice and 20% for HtrA1 Tg mice, but had no effect on ARMS2 Tg mice.
25205864 Index variants of AMD, rs1061170 (CFH) and rs10490924 (ARMS2), were associated with AMD at P=3.05x10(-8) and P=6.36x10(-6), respectively, in European Americans.
25200399 The benefit of the AREDS formulation seems the result of a favorable response by patients in only 1 genotype group, balanced by neutral or unfavorable responses in 3 genotype groups.
25185256 This study shows an association between A69S polymorphism in the ARMS2 gene and the anti-angiogenesis treatment response.
25091949 The combined geographic atrophy/choroidal neovascularization phenotype has similar epidemiologic, clinical, and genetic features.
25077532 High-risk alleles in the CFH and ARMS2/HTRA1 genes were not associated with increasing autosomal dominant radial drusen severity.
24974817 Genotypes at the CFH and ARMS2 loci did not statistically significantly alter the benefits of Age-Related Eye Disease Study (AREDS) supplements.
24970616 Variants in CFH, ABCA1, and ARMS2 genes are related to the presence and progression of drusen in early age-related macular degeneration.
24953792 There were no statistically significant interactions between current smoking or pack-years smoked and CFH or ARMS2 genotype in age-related macular degeneration.
24865190 Gene variants in CFH, ARMS2 and HTRA1 are related to an increased risk of age-related macular degeneration in a northern Chinese population.
24847905 The association with the CFH Y402 risk allele was less pronounced in retinal angiomatous proliferation patients (RAP) than in non-RAP CNV patients, while the association with high age and arterial hypertension appeared to be stronger.
24781946 In terms of ARMS2 and CFH, genetic background of patients with CVH and type 1 CNV was different from those with AMD, but rather similar to the general Japanese population.
24612979 This study did not show a correlation between ARMS2, C3, MT-NDH2, and CFH alleles in the development of choroid neovascularization associated with ocular histoplasmosis.
24595987 Eyes with exudative macular degeneration, reticular pseudodrusen is more common in eyes with retinal angiomatous proliferation having a thin choroid at the fovea, especially in old, female patients with the risk variant of ARMS2 A69S.
24557084 we have assessed the relationship between GA and previously identified AMD-associated variants of genes (CFH, CFB, C3, FHR1, FRH3, and ARMS2/HTRA).
24453474 ARMS2 and C3 are major contributors to advanced age-related macular degeneration in Mexican patients, while the contributions of CFH, C2, and CFB are minor to those of other populations.
24397185 The risk variants of ARMS2 A69S were associated with hemorrhagic and sub-pigment epithelial lesions and with bilaterality. Genotyping of ARMS2 A69S is useful in understanding clinical features in PCV.
24372405 These results suggest that there is a contribution of the rs10490924 SNP of the LOC387715/ARMS2 gene to AMD susceptibility in this sample of the Brazilian population.
24362810 Exudative age-related macular degeneration is associated with CFH Y402H and ARMS2 A69S polymorphisms, smoking and with nutritional factors; a decreased risk with dietary omega-3 fatty acids and fruits.
24240564 study revealed significant relationships between the plasma malondialdehyde level and ARMS2 variants and phenotypes in polypoidal choroidal vasculopathy and neovascular age-related macular degeneration
24217333 These data suggest that polymorphisms of the ARMS2 do not modify the progression of the central field of vision in RP patients.
24013816 This study provides evidence of the joint contribution of genetic variants in PLEKHA1/ARMS2/HTRA1 to age-related macular degeneration risk.
23972322 Patients with no CFH risk alleles and with 1 or 2 ARMS2 risk alleles derived maximum benefit from zinc-only supplementation. Patients with one or two CFH risk alleles and no ARMS2 risk alleles derived maximum benefit from antioxidant-only supplementation
23959158 our data indicate that the change in ARMS2 may affect C3, C5, IL-6, IL-8, and TNF-alpha levels, and this may be one of the mechanisms of AMD development.
23942973 There was no significant difference in two ARMS2 transcript splice isoforms among retina-RPE-choroid samples carrying different genotypes at variants R38X and the indel in age related macualr degeneration.
23867343 CFH and ARMS2 polymorphisms were strongly associated with AMD in this Brazilian cohort.
23697955 the ARMS2 A69S variant is associated with an increased risk of polypoidal choroidal vasculopathy in the Asian population. Patients with the A69S variant may have a somewhat higher risk of developing PCV compared with controls.
23687431 The association of ARMS2/HTRA1 and CFH single nucleotide polymorphisms in early age-related maculopathy was not detected in this cohort.
23592919 The association of the del443ins54 of ARMS2 in two ethnically different populations from India and Australia, was investigated.
23582991 The HTRA1 promoter SNP (rs11200638) and A69S at LOC387715/ARMS2 were associated with a poorer visual outcome for ranibizumab or bevacizumab treatment in neovascular AMD.
23572227 Letter: ARMS2 A69S variant is most likely to influence risk of age-related macular degeneration.
23534868 Our results show that genotypes of ARMS2 (rs10490923), HTRA1 (rs112000638) and CFH (rs1410996) polymorphisms are related to an increased risk of suffering AMD in Spanish patients.
23494043 These population-based data provide estimates of the long-term risk of the incidence and progression of AMD and its lesions by age and genetic risk alleles for CFH and ARMS2.
23414945 Haplotypes which combine "risk genotypes" of our analyzed polymorphisms are more frequent in patients with AMD than in the control group, and they seem to increase the risk of suffering the disease in our population
23362846 Our data demonstrates significant association between AMD and rs1061170 on CFH, rs10490924 on ARMS2 and rs11200638 on HTRA1 in Egyptian patients. These findings are in agreement with previous findings in Caucasians.
23337555 Although specific alleles for CFH, ARMS2, HTRA1, and C3 may predict the development of AMD, they did not predict response to anti-vascular endothelial growth factor therapy.
23326481 There is a strong and consistent association of the ARMS2/HTRA1 locus with both neovascular age-related macular degeneration and polypoidal choroidal vasculopathy.
23315805 The ARMS2 rs10490924 polymorphism plays an important role in polypoidal choroidal vasculopathy susceptibility. [Meta-analysis]
23296223 ARMS2 does not seem to be associated either with retinopathy or coronary artery disease
23289808 There may be significantly different associations in the genetic variants of ARMS2 between two angiographic phenotypes of polypoidal choroidal vasculopathy (PCV).
23289807 Korean individuals with the LOC387715/ARMS2 rs10490924, and to a lesser extent, CFH rs800292 variants might be at a greater risk for the development of exudative age-related macular degeneration (AMD)
23112567 CFH, ARMS2, and CFB AMD-risk alleles are consistently associated with the disease, even in ethnic groups with a complex admixture of ancestral populations such as Mexican mestizos.
23111182 The prevalence of reticular pseudodrusen was low in PCV cases. About 50% of patients with reticular pseudodrusen had bilateral late AMD. The connection of ARMS2 risk allele and reticular pseudodrusen was confirmed in a Japanese population.
23098369 A strong association was demonstrated between all stages of AMD and genetic variation in ARMS2, and a significant gene-environment interaction with cigarette smoking was confirmed.
23060141 Two variants in ARMS2/HTRA1 were associated with increased risk of early AMD, and for one of these, the increased risk was also evident for late AMD.
22977134 The rs754203 C allele in the CYP46A1 gene may confer a higher risk for exudative age-related macular degeneration in patients who carry no risk alleles in the CFH and LOC387715 genes.
22893087 TT genotype was associated with very high risk for all types of age-related macular degeneration (ARM), with increasing odds ratios according to the severity of ARM
22840423 A cumulative effect of high-risk alleles in CFH, ARMS2, and VEGFA seems to be associated with a younger age of onset in combination with poor response rates to ranibizumab treatment.
22809783 ARMS2 A69S genotype is associated with second-eye involvement of exudative age-related macular degeneration and with the period between first- and second-eye involvements.
22705344 ARMS2/HTRA1 locus confers increased risk for both advanced age-related macular degeneration subtypes, but imparts greater risk for choroid neovascularization than for geographic atrophy.
22552255 Our findings indicate that CFH (rs1061170) polymorphism impacts significantly on retinal function in early AMD patients.
22509112 LOC387715 (ARMS2) rs10490924 was the only variant showing a significant difference between polypoidal choroidal vasculopathy and wet age-related macular degeneration. (Review)
22491416 There is a strong and consistent association of the ARMS2/HTRA1 locus with both exudative AMD and PCV, suggesting the two disorders share, at least partially, similar molecular mechanisms.
22487577 ARMS2/HTRA1 risk genotype may play a role in determining neovascular subphenotype, whereas genetics/demographics, smoking, and systemic health factors contribute to the development of advanced AMD in the presence of early AMD.
22481475 The ARMS2 A69S substitution may serve as a marker for bilateral advanced AMD.
22293892 etiologic role in ARMD of A69S ARMS2 and Y402H CFH gene variants were confirmed in a Polish population for the first time. R38X variant of ARMS2 seems to be protective from wet ARMD
22232482 genetic tests that naively incorporate ARMS2 A69S without considering ancestry will consistently give incorrect results to non-Hispanic black individuals.
22219653 ARMS2 A69S variant confers a significantly higher risk of neovascular age-related macular degeneration than polypoidal choroidal vasculopathy.
22138417 The novel ARMS2 splice variant is the major transcript isoform in retina, which is expressed in a higher level in choroid/RPE than in retina.
22133792 The current study found evidence showing that in age-related macular degeneration risk alleles in CFH and ARMS2 are independently associated with complement activation.
22065928 There were significant differences between the controls and the age-related macular degeneration (AMD) patients in genotype distributions. This was true for all AMD subtype analyses of both rs800292 (complement factor H) and rs10490924 (ARMS2).
22035603 Our investigation of the gene-environment interaction involved in age-related macular degeneration revealed a relationship between a plasma biomarker of oxidative stress, CySS, and CFH genotype.
21959923 The ARMS2 (rs10490924)/HTRA1 (rs11200638) variants are significantly associated with the risk of polypoidal choroidal vasculopathy (PCV) in a Korean population.
21896867 The rs800292 variant of the CFH gene is a potential marker for typical choroid neovascularization (CNV). The rs10490924 variant of the ARMS2 gene was shown to be associated with polypoidal CNV.
21855673 Our results of a negative association between variants of the LOXL1 gene and exudative AMD suggest that the involvement of rs1048661 in the LOXL1 gene as a risk allele for exudative AMD might be small if present.
21825189 The AMD-associated CFH 402H risk variant is associated with the absence of RMD (reticular macular disease) but enhanced risk for RMD is conferred by the ARMS2 69S AMD risk allele.
21816153 This study did not detect an association between individual age-related macular degeneration risk genotypes and the putatively protective macular pigments, or serum concentrations of its constituent carotenoids
21790300 showing that Y402H and LOC387715 are associated with age-related macular degeneration in Turkish population
21784201 Our results suggest that rs1048661 in LOXL1 is not implicated in the development of AMD in the Italian population in spite of a very good statistical power to replicate the reported strong associations.
21541271 ARMS2 variants are likely associated with the phenotype and the effects of photodynamic therapy in typical neovascular age-related macular degeneration (tAMD) and polypoidal choroidal vasculopathy (PCV).
21397333 ARMS2 A69S variants were significantly associated with hemorrhagic or subpigment epithelium lesions of polypoidal choroidal vasculopathy, and with earlier onset and bilateral involvement.
21282580 the association with the known genetic susceptibility loci CFH, HTRA1, and AMRS2 were confirmed, and a risk-conferring polymorphism in one new locus, LRP5, was identified.
21252205 pathogenic effects due to ARMS2 protein deficiency are unlikely to account for AMD pathology.
21236409 These findings suggest that there is a significant association between the ARMS2 gene and LOXL1 gene in exudative age-related macular degeneration.
21203342 An age-dependent elevation of serum hs-CRP levels may be accelerated in normal subjects with one or two risk alleles in the ARMS2/HTRA1 locus compared to those with homozygous wild-type alleles.
21191724 The association pattern and haplotype estimation in the ARMS2/HTRA1 region of Japanese patients with polypoidal choroidal vasculopathy were very similar to those of Japanese patients with typical neovascular age-related macular degeneration.
21122828 Genetic variation at the ARMS2/HTRA1 locus confers a differential risk for choroid neovascularization vs geographic atrophy in a well-powered sample.
21106043 Our findings show that CFH and ARMS2 genes seem to be the principal risk loci contributing independently to age-related macular degeneration in our cohort.
21031019 Both HTRA1 rs11200638 G-->A polymorphism and LOC387715/ARMS2 rs10490924 G-->T polymorphism play important roles in the pathogenesis of age-related macular degeneration.
21031019 Meta-analysis and HuGE review of gene-disease association. (HuGE Navigator)
20888482 Observational study of gene-disease association. (HuGE Navigator)
20881291 This is the first study to relate age-related maculopathy (ARM) risk genotypes with mesopic visual function in clinically normal persons.
20881291 Observational study of gene-disease association. (HuGE Navigator)
20878164 While ARMS2 seems to primarily influence the progression to exudative AMD, CFH seems equally related to the development of the exudative and atrophic forms of late AMD.
20861866 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20801516 Observational study of genetic testing. (HuGE Navigator)
20688737 Complement factor H Y402H and LOC387715 A69S are both significantly associated with polypoidal choroidal vasculopathy (PCV). Cigarette smoking is an environmental risk factor for PCV.
20688737 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20671585 There is a pharmacogenetic association between the LOC387715 A69S variant and the long-term results after photodynamic therapy in eyes with polypoidal choroidal vasculopathy (PCV).
20671585 Observational study of gene-disease association. (HuGE Navigator)
20664795 Observational study of gene-disease association. (HuGE Navigator)
20664794 ARMS2 and HTRA1 mRNA levels did not show a significant difference in expression among the control (young and elderly) and age-related macular degeneration retinas.
20664794 Observational study of gene-disease association. (HuGE Navigator)
20574013 CFH Y402H is associated with age-related macular degeneration (AMD), typical (t)AMD, polypoidal choroidal vasculopathy (PCV), whereas I62V is associated with all three subtypes.
20574013 Observational study of gene-disease association. (HuGE Navigator)
20456446 study demonstrated the significant association of the 10q26 SNPs (HTRA1 and LOC387715) in an age-related macular degeneration cohort from Korea and was consistent with previous studies from other populations
20456446 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20413980 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20385819 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20381870 Observational study of gene-disease association. (HuGE Navigator)
20378180 The polypoidal choroidal vasculopathy (PCV) phenotype in Caucasian patients is associated with the major alleles/genotypes in the age-related macular degeneration (AMD)-associated loci, suggesting that PCV and AMD are genetically similar.
20378180 Observational study of gene-disease association. (HuGE Navigator)
20346514 High-sensitivity CRP and polymorphisms in the CFH and ARMS2/HTRA1 genes are independently associated with risk of age-related macular degeneration (AMD). Higher CRP level tends to confer a higher risk of AMD within most genotype groups.
20346514 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20238042 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20157618 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20157352 Observational study of gene-disease association. (HuGE Navigator)
20140183 These data implicate increased HTRA1 expression in the pathogenesis of age-related macular degeneration.
20042647 This study demonstrates an association between the at-risk allele of the ARMS2/LOC387715 locus and classic CNV, fibrovascular lesions, and poor visual acuity.
20042647 Observational study of gene-disease association. (HuGE Navigator)
20022638 Observational study of gene-disease association. (HuGE Navigator)
20007824 Observational study of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19933195 The results replicate the previously reported association between the high-risk alleles and AMD (age-related maculopathy) and confirm, an association with AMD and the indel (del443ins54) polymorphism in a Caucasian population.
19933195 Observational study of gene-disease association. (HuGE Navigator)
19933179 These findings provide the first evidence suggesting that ARMS2 interacts with hormone replacement therapy to modulate age-related macular degeneration (AMD) risk and are consistent with previous reports.
19933179 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19898184 The LOC387715 A69S genotype is not associated with lesion composition or size on indocyanine green angiography but with lesion size on fluorescein angiography in patients with subfoveal polypoidal choroidal vasculopathy.
19898184 Observational study of gene-disease association. (HuGE Navigator)
19892838 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19845562 The CFH, LOC387715 and HTRA1 polymorphisms are strongly associated with the development of age-related macular degeneration in the Hungarian population
19845562 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19823576 variants at CFH, C3, and ARMS2 confer significant risks for geographic atrophy due to age-related macular degeneration
19823576 Observational study of gene-disease association. (HuGE Navigator)
19822855 To our knowledge, this is the first confirmation of the association of del443ins54 in Italian patients with age-related macular degeneration, and we also confirmed the association of Tyr402His with CFH.
19822855 Observational study of gene-disease association. (HuGE Navigator)
19797206 The findings indicate that age-related maculopathy (AMD) progression is differentially affected by genotypic variants.
19796758 Several polymorphisms examined in the LOC387715/ARMS2/HTRA1 locus, but none in the CFH region, correlated with specific phenotypic attributes of AMD.
19680273 three AMD-associated SNPs (rs10490924 (A69S) of ARMS2/LOC387715, rs11200638 of HTRA1, and rs1061170 (Y402H) of CFH)do not contribute significantly to the development of choroidal neovascularization in highly myopic eyes of the elderly Japanese.
19680273 Observational study of gene-disease association. (HuGE Navigator)
19661236 Observational study of gene-disease association. (HuGE Navigator)
19568762 The replication of the reported associations of CFH T1277C polymorphism with age-related macular degeneration (AMD) suggest that the 1277C allele could serve as a high-risk genetic marker for the disease.
19491722 Both HTRA1 SNPs are significantly associated with exudative age-related macular degeneration(AMD) in Chinese cohort and seem to contribute equally to disease status.
19491722 Observational study of gene-disease association. (HuGE Navigator)
19268887 Observational study of gene-disease association. (HuGE Navigator)
19259132 Data show that SNP rs10490924 on chromosome 10 in exon 1 of the ARMS2 gene has highly significant association with an odds ratio of 3.2 for the risk allele with AMD cases.
19259132 Observational study of gene-disease association. (HuGE Navigator)
19255159 ARMS2 was mainly distributed in the cytosol, not in the mitochondrial outer membrane as previously reported
19255159 Observational study of gene-disease association. (HuGE Navigator)
19202148 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19197355 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
19169232 Observational study of gene-disease association. (HuGE Navigator)
19168221 Observational study and meta-analysis of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19117936 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19065273 The rs10490924 Single nucleotide polymorphisms (SNP) in LOC387715/ARMS2 and the rs11200638 SNP in HTRA1 are strongly associated with neovascular age-related macular degeneration in this Israeli population.
19065273 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19048105 A tentative gene-gene interaction between the two major age-related macular degeneration-associated loci, LOC387715 and complement factor H, was found in this study.
19048105 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19001225 Observational study of gene-disease association. (HuGE Navigator)
18936151 Observational study of gene-disease association. (HuGE Navigator)
18855541 ARMS2 genotype is reported for age-related macular degeneration.
18762075 We did not find a positive association in high myopia. Based on these results, neither the Y402H nor the A69S single nucleotide polymorphisms seem to be involved in the choroid neovascularization process in high myopia patients.
18688167 The LOC387715/ARMS2 gene is expressed in the human brain, and it may concur to the individual risk for Alzheimer's disease
18688167 Observational study of gene-disease association. (HuGE Navigator)
18682812 The purpose of this study was to investigate the association of reported common single-nucleotide polymorphisms (SNPs) in CFH, LOC387715, and HTRA1 with exudative age-related macular degeneration in a northern Chinese population.
18682806 Both the HTRA1 and LOC387715/ARMS2 single nucleotide polymorphysms appear to contribute equally to disease risk (both geographic atrophy and choroidal neovascularization) with no evidence of interaction with CFH.
18682806 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18569809 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18544707 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18515590 Observational study of gene-disease association. (HuGE Navigator)
18511946 Age-related macular degeneration is associated with an unstable ARMS2 (LOC387715) mRNA.
18511946 a deletion-insertion polymorphism in ARMS2 is strongly associated with AMD, directly affecting the transcript by removing the polyadenylation signal and inserting a 54-bp element known to mediate rapid mRNA turnover.
18493315 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18461138 Observational study of gene-disease association. (HuGE Navigator)
18452766 our results showed that in Spanish patients with AMD the associations of both polymorphisms are not equal: Y402H is associated with early and wet AMD, whereas A69S is associated only with wet AMD.
18436811 The present data provided an independent validation of the association of LOC387715 and HTRA1 SNPs, along with their risk estimates among Indian patients with AMD.
18436811 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18423869 The findings of this study indicate that an individual's response to age-related eye disease supplements may be related to complement factor H genotype.
18423869 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18400199 The LOC387715 polymorphism is associated with polypoidal choroidal vasculopathy (PCV)and clinical severity in the subgroups of PCV in the Japanese population.
18400199 Observational study of gene-disease association. (HuGE Navigator)
18325906 Observational study of gene-disease association. (HuGE Navigator)
18292785 Observational study of gene-disease association. (HuGE Navigator)
18248681 Observational study of genotype prevalence. (HuGE Navigator)
18164066 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18162041 CFH and ARMS2 haplotypes and smoking exerted large effects on AMD risk. CFH haplotypes conferred ORs from 1 to 4.17. Homozygotes for ARMS2 were at very high risk for AMD. Risk of wet AMD rose to 15.5% in 1/10 of the population with highest predicted risk.
18162041 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18162041 Polymorphisms in the complement factor H gene, LOC387715, and the HTRA1 promoter are strongly associated with age-related macular degeneration.
18161619 Observational study of gene-disease association. (HuGE Navigator)
18079691 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18079691 Although a role for PLEKHA1 could not be totally excluded, there was a four times higher age-related macular degeneration risk was associated with haplotype "A-T-A" involving "PLEKHA1-LOC387715-HTRA1" risk alleles.
18061132 Observational study of gene-disease association. (HuGE Navigator)
18054635 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18054635 The Age-related macular degeneration associated complement factor H Y402H and LOC387715 A69S variants were associated with differences in choroidal neovascular lesion size in this study.
17884985 Observational study of gene-disease association. (HuGE Navigator)
17884985 SNP rs10490924 represents a major susceptibility variant for age-related macular degeneration. A likely biological mechanism is that the A69S change in the LOC387715/ARMS2 protein affects its presumptive function in mitochondria.
17846368 Both ARMS2 polymorphism and complement factor H polymorphism are independently associated with progression of age-related macular degeneration.
17692272 The LOC387715/HTRA1 variants are associated with polypoidal choroidal vasculopathy (PCV) and wet age-related macular degeneration (AMD) in the Japanese population.
17675241 Combined effects for the LOC387715 genotypes with 3 inflammatory markers and PAI-1 on the risk of early or late age-related macular degeneration(AMD), and with current smoking on the risk of late AMD.
17456821 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17426452 Observational study of gene-disease association. (HuGE Navigator)
17352366 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
17347568 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17347568 The number of risk alleles at the LOC387715 SNP was associated with advanced Age-related macular degeneration
17325155 Observational study of gene-disease association. (HuGE Navigator)
17325155 AMD (age-related macular degeneration) genetic risk marker harbored within LOC387715, the nested case-control data from the population-based BMES samples showed lower estimates than from the clinic-based samples.
17285240 findings suggest that the combined effect of variants in the CFH and LOC 387715 genes may contribute to the age-related macular degeneration phenotype in this family
17194541 A polymorphism of LOC387715 gene is associated with age-related macular degeneration in the Japanese population.
17000705 study provides additional support for the CFH and LOC387715 genes in age-related maculopathy (ARM) susceptibility via the evaluation of cohorts that had different ascertainment schemes regarding ARM status and through the meta-analyses
16954704 Results further support the notion that CFH (complement factor H) and LOC387715 genes are the major risk factors for ARMD.
16642439 Our results strongly implicate a coding change (Ala69Ser) in the LOC387715 gene as the second major identified AMD-susceptibility allele, confirming earlier suggestions. This variant's effect on AMD is statistically independent of CFH .
16174643 Hypothetical LOC387715 is a second major susceptibility gene for age-related macular degeneration, contributing independently of complement factor H to disease risk.

AA Sequence

MLRLYPGPMVTEAEGKGGPEMASLSSSVVPVSFISTLRESVLDPGVGGEGASDKQRSKLSLSHSMIPAAK      1 - 70
IHTELCLPAFFSPAGTQRRFQQPQHHLTLSIIHTAAR                                      71 - 107
//

Text Mined References (192)

PMID Year Title
26427389 2016 Gene Structure of the 10q26 Locus: A Clue to Cracking the ARMS2/HTRA1 Riddle?
26337002 2015 MMP20 and ARMS2/HTRA1 Are Associated with Neovascular Lesion Size in Age-Related Macular Degeneration.
26275133 2015 The Contribution of Genetic Architecture to the 10-Year Incidence of Age-Related Macular Degeneration in the Fellow Eye.
26132079 2015 CFH Y402H and ARMS2 A69S Polymorphisms and Oral Supplementation with Docosahexaenoic Acid in Neovascular Age-Related Macular Degeneration Patients: The NAT2 Study.
25792034 2015 Calcium, ARMS2 genotype, and Chlamydia pneumoniae infection in early age-related macular degeneration: a multivariate analysis from the Nagahama study.
25786237 2015 Lens status influences the association between CFH polymorphisms and age-related macular degeneration: findings from two population-based studies in Singapore.
25771815 2015 Gene-gene interaction of CFH, ARMS2, and ARMS2/HTRA1 on the risk of neovascular age-related macular degeneration and polypoidal choroidal vasculopathy in Chinese population.
25715554 [Age-related macular degeneration].
25695752 2015 Association of Smoking and CFH and ARMS2 Risk Variants With Younger Age at Onset of Neovascular Age-Related Macular Degeneration.
25519903 2015 HTRA1 (high temperature requirement A serine peptidase 1) gene is transcriptionally regulated by insertion/deletion nucleotides located at the 3' end of the ARMS2 (age-related maculopathy susceptibility 2) gene in patients with age-related macular degeneration.
25439433 2015 Chronic central serous chorioretinopathy is associated with genetic variants implicated in age-related macular degeneration.
25205867 2014 Overexpression of HtrA1 and exposure to mainstream cigarette smoke leads to choroidal neovascularization and subretinal deposits in aged mice.
25205864 2014 Genetic determinants of age-related macular degeneration in diverse populations from the PAGE study.
25200399 2015 Treatment response to antioxidants and zinc based on CFH and ARMS2 genetic risk allele number in the Age-Related Eye Disease Study.
25185256 2015 Association between variants A69S in ARMS2 gene and response to treatment of exudative AMD: a meta-analysis.
25091949 2014 Risk characteristics of the combined geographic atrophy and choroidal neovascularisation phenotype in age-related macular degeneration.
25077532 2015 Comparison of drusen and modifying genes in autosomal dominant radial drusen and age-related macular degeneration.
24974817 2014 No clinically significant association between CFH and ARMS2 genotypes and response to nutritional supplements: AREDS report number 38.
24970616 2014 The contribution of genetic factors to phenotype and progression of drusen in early age-related macular degeneration.
24953792 2014 Cigarette smoking and the natural history of age-related macular degeneration: the Beaver Dam Eye Study.
24865190 2014 Association of specific genetic polymorphisms with age-related macular degeneration in a northern Chinese population.
24847905 2014 Environmental and genetic risk factors for retinal angiomatous proliferation.
24781946 2014 Choroidal neovascularization in eyes with choroidal vascular hyperpermeability.
24612979 2014 Investigation of choroidal neovascularization risk alleles in ocular histoplasmosis.
24595987 2014 Genetic and clinical factors associated with reticular pseudodrusen in exudative age-related macular degeneration.
24557084 2014 Growth of geographic atrophy on fundus autofluorescence and polymorphisms of CFH, CFB, C3, FHR1-3, and ARMS2 in age-related macular degeneration.
24453474 2014 CFH haplotypes and ARMS2, C2, C3, and CFB alleles show association with susceptibility to age-related macular degeneration in Mexicans.
24397185 2013 [Association of the ARMS2 gene with clinical features in polypoidal choroidal vasculopathy].
24372405 2015 Association of LOC387715/ARMS2 (rs10490924) Gene Polymorphism with Age-Related Macular Degeneration in the Brazilian Population.
24362810 2014 Risk factors for exudative age-related macular degeneration in a large French case-control study.
24240564 2014 Association of plasma malondialdehyde with ARMS2 genetic variants and phenotypes in polypoidal choroidal vasculopathy and age-related macular degeneration.
24217333 2014 Exclusion of influences of ARMS2 polymorphisms on the central visual field in retinitis pigmentosa.
24013816 2013 Cumulative association between age-related macular degeneration and less studied genetic variants in PLEKHA1/ARMS2/HTRA1: a meta and gene-cluster analysis.
23972322 2013 CFH and ARMS2 genetic polymorphisms predict response to antioxidants and zinc in patients with age-related macular degeneration.
23959158 2013 ARMS2 interference leads to decrease of proinflammatory mediators.
23942973 2013 AMD-associated variants at the chromosome 10q26 locus and the stability of ARMS2 transcripts.
23867343 2013 Association analysis of CFH and ARMS2 gene polymorphisms in a Brazilian cohort with age-related macular degeneration.
23697955 2013 The age-related maculopathy susceptibility 2 polymorphism and polypoidal choroidal vasculopathy in Asian populations: a meta-analysis.
23687431 2013 No association of age-related maculopathy susceptibility protein 2/HtrA serine peptidase 1 or complement factor H polymorphisms with early age-related maculopathy in a Chinese cohort.
23592919 2013 Association of the del443ins54 at the ARMS2 locus in Indian and Australian cohorts with age-related macular degeneration.
23582991 2013 Genetic influences on the outcome of anti-vascular endothelial growth factor treatment in neovascular age-related macular degeneration.
23577725 2013 Genetic factors in nonsmokers with age-related macular degeneration revealed through genome-wide gene-environment interaction analysis.
23572227 2013 Coding variants in ARMS2 and the risk of age-related macular degeneration.
23534868 2014 CFH (rs1410996), HTRA1 (rs112000638) and ARMS2 (rs10490923) gene polymorphisms are associated with AMD risk in Spanish patients.
23494043 2013 Risk alleles in CFH and ARMS2 and the long-term natural history of age-related macular degeneration: the Beaver Dam Eye Study.
23455636 2013 Seven new loci associated with age-related macular degeneration.
23414945 2013 Influence of CFH, HTRA1 and ARMS2 haplotype polymorphisms in the development of age-related macular disease.
23362846 2013 Association of single nucleotide polymorphisms in CFH, ARMS2 and HTRA1 genes with risk of age-related macular degeneration in Egyptian patients.
23337555 2013 Pharmacogenetics for genes associated with age-related macular degeneration in the Comparison of AMD Treatments Trials (CATT).
23326517 2013 Insights into the genetic architecture of early stage age-related macular degeneration: a genome-wide association study meta-analysis.
23326481 2013 Genetic and functional dissection of ARMS2 in age-related macular degeneration and polypoidal choroidal vasculopathy.
23315805 2012 Meta-analysis of the relationship between the LOC387715/ARMS2 polymorphism and polypoidal choroidal vasculopathy.
23296223 [Role of CFH and ARMS2 polymorphisms in retinopathy and coronary artery disease in type 1 diabetes].
23289808 2013 The association of age-related maculopathy susceptibility 2 (ARMS2) and complement factor H (CFH) variants with two angiographic subtypes of polypoidal choroidal vasculopathy.
23289807 2013 Gene-gene interactions of CFH and LOC387715/ARMS2 with Korean exudative age-related macular degeneration patients.
23112567 2012 Susceptibility to advanced age-related macular degeneration and alleles of complement factor H, complement factor B, complement component 2, complement component 3, and age-related maculopathy susceptibility 2 genes in a Mexican population.
23111182 2013 Prevalence and genomic association of reticular pseudodrusen in age-related macular degeneration.
23098369 2013 ARMS2 increases the risk of early and late age-related macular degeneration in the European Eye Study.
23060141 2012 Polymorphisms in ARMS2/HTRA1 and complement genes and age-related macular degeneration in India: findings from the INDEYE study.
22977134 2012 Single nucleotide polymorphism in the cholesterol-24S-hydroxylase (CYP46A1) gene and its association with CFH and LOC387715 gene polymorphisms in age-related macular degeneration.
22893087 2012 ARMS2 A69S polymorphism and the risk for age-related maculopathy: the ALIENOR study.
22840423 2012 Cumulative effect of risk alleles in CFH, ARMS2, and VEGFA on the response to ranibizumab treatment in age-related macular degeneration.
22809783 2012 Association of ARMS2 genotype with bilateral involvement of exudative age-related macular degeneration.
22705344 2012 Heritability and genome-wide association study to assess genetic differences between advanced age-related macular degeneration subtypes.
22694956 2012 Genome-wide association study of age-related macular degeneration identifies associated variants in the TNXB-FKBPL-NOTCH4 region of chromosome 6p21.3.
22552255 2012 Retinal function and CFH-ARMS2 polymorphisms analysis: a pilot study in Italian AMD patients.
22509112 2012 Genetic associations in polypoidal choroidal vasculopathy: a systematic review and meta-analysis.
22491416 2012 Differentiation of exudative age-related macular degeneration and polypoidal choroidal vasculopathy in the ARMS2/HTRA1 locus.
22487577 2012 Genotype-phenotype associations in neovascular age-related macular degeneration.
22481475 2012 The ARMS2 A69S variant and bilateral advanced age-related macular degeneration.
22293892 2012 A69S and R38X ARMS2 and Y402H CFH gene polymorphisms as risk factors for neovascular age-related macular degeneration in Poland - a brief report.
22232482 2012 Population differences in genetic risk for age-related macular degeneration and implications for genetic testing.
22219653 2011 Difference between age-related macular degeneration and polypoidal choroidal vasculopathy in the hereditary contribution of the A69S variant of the age-related maculopathy susceptibility 2 gene (ARMS2).
22138417 2012 A novel ARMS2 splice variant is identified in human retina.
22133792 2012 Risk alleles in CFH and ARMS2 are independently associated with systemic complement activation in age-related macular degeneration.
22065928 2011 Analysis of candidate genes for age-related macular degeneration subtypes in the Japanese population.
22035603 2012 Plasma biomarkers of oxidative stress and genetic variants in age-related macular degeneration.
21959923 2012 Association of ARMS2/HTRA1 variants with polypoidal choroidal vasculopathy phenotype in a Korean population.
21896867 2011 Associations of complement factor H (CFH) and age-related maculopathy susceptibility 2 (ARMS2) genotypes with subtypes of polypoidal choroidal vasculopathy.
21855673 2011 Polymorphisms in ARMS2 (LOC387715) and LOXL1 genes in the Japanese with age-related macular degeneration.
21825189 2011 Complement factor H 402H variant and reticular macular disease.
21816153 2011 The association between macular pigment optical density and CFH, ARMS2, C2/BF, and C3 genotype.
21790300 2012 Age-related macular degeneration and association of CFH Y402H and LOC387715 A69S polymorphisms in a Turkish population.
21784201 2011 Polymorphisms in ARMS2 (LOC387715) and LOXL1 genes in the Japanese with age-related macular degeneration.
21665990 2011 Common variants near FRK/COL10A1 and VEGFA are associated with advanced age-related macular degeneration.
21541271 2011 The association of age-related maculopathy susceptibility 2 polymorphisms with phenotype in typical neovascular age-related macular degeneration and polypoidal choroidal vasculopathy.
21397333 2011 Role of complement factor H I62V and age-related maculopathy susceptibility 2 A69S variants in the clinical expression of polypoidal choroidal vasculopathy.
21282580 2011 Genetic association with response to intravitreal ranibizumab in patients with neovascular AMD.
21252205 2011 Risk- and non-risk-associated variants at the 10q26 AMD locus influence ARMS2 mRNA expression but exclude pathogenic effects due to protein deficiency.
21236409 2011 Polymorphisms in ARMS2 (LOC387715) and LOXL1 genes in the Japanese with age-related macular degeneration.
21203342 2010 Elevated C-reactive protein levels and ARMS2/HTRA1 gene variants in subjects without age-related macular degeneration.
21191724 2010 Haplotype analysis of the ARMS2/HTRA1 region in Japanese patients with typical neovascular age-related macular degeneration or polypoidal choroidal vasculopathy.
21122828 2011 ARMS2/HTRA1 locus can confer differential susceptibility to the advanced subtypes of age-related macular degeneration.
21106043 2011 Genetic association study of age-related macular degeneration in the Spanish population.
21031019 2010 LOC387715/HTRA1 gene polymorphisms and susceptibility to age-related macular degeneration: A HuGE review and meta-analysis.
20888482 2010 Serum lipid biomarkers and hepatic lipase gene associations with age-related macular degeneration.
20881291 2011 Persons with age-related maculopathy risk genotypes and clinically normal eyes have reduced mesopic vision.
20878164 2010 [Genetic and risk factors for exudative AMD].
20861866 2010 Genome-wide association identifies SKIV2L and MYRIP as protective factors for age-related macular degeneration.
20801516 2011 Simultaneous mutation detection in 90 retinal disease genes in multiple patients using a custom-designed 300-kb retinal resequencing chip.
20688737 2010 Joint effect of cigarette smoking and CFH and LOC387715/HTRA1 polymorphisms on polypoidal choroidal vasculopathy.
20671585 Association of LOC387715 A69S genotype with visual prognosis after photodynamic therapy for polypoidal choroidal vasculopathy.
20664795 2010 R102G polymorphism of the C3 gene associated with exudative age-related macular degeneration in a French population.
20664794 2010 Age-related macular degeneration-associated variants at chromosome 10q26 do not significantly alter ARMS2 and HTRA1 transcript levels in the human retina.
20574013 2010 CFH and ARMS2 variations in age-related macular degeneration, polypoidal choroidal vasculopathy, and retinal angiomatous proliferation.
20456446 2010 LOC387715/HTRA1 polymorphisms, smoking and combined effects on exudative age-related macular degeneration in a Korean population.
20413980 2010 Genome-wide conditional search for epistatic disease-predisposing variants in human association studies.
20385826 2010 Genome-wide association study of advanced age-related macular degeneration identifies a role of the hepatic lipase gene (LIPC).
20385819 2010 Genetic variants near TIMP3 and high-density lipoprotein-associated loci influence susceptibility to age-related macular degeneration.
20381870 2010 Progression of geographic atrophy and genotype in age-related macular degeneration.
20378180 2010 Three major loci involved in age-related macular degeneration are also associated with polypoidal choroidal vasculopathy.
20346514 2010 C-reactive protein and CFH, ARMS2/HTRA1 gene variants are independently associated with risk of macular degeneration.
20238042 2010 Proteomic and genomic biomarkers for age-related macular degeneration.
20157618 2010 Complement component 3: an assessment of association with AMD and analysis of gene-gene and gene-environment interactions in a Northern Irish cohort.
20157352 2009 Genetic analysis of typical wet-type age-related macular degeneration and polypoidal choroidal vasculopathy in Japanese population.
20140183 2010 Genetic and functional dissection of HTRA1 and LOC387715 in age-related macular degeneration.
20042647 2010 Genotypic influences on severity of exudative age-related macular degeneration.
20022638 2010 The complement component 5 gene and age-related macular degeneration.
20007824 2010 Small, hard macular drusen and peripheral drusen: associations with AMD genotypes in the Inter99 Eye Study.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19933195 2010 Analysis of six genetic risk factors highly associated with AMD in the region surrounding ARMS2 and HTRA1 on chromosome 10, region q26.
19933179 2010 Inverse association of female hormone replacement therapy with age-related macular degeneration and interactions with ARMS2 polymorphisms.
19898184 Angiographic lesion size associated with LOC387715 A69S genotype in subfoveal polypoidal choroidal vasculopathy.
19892838 2010 Polymorphisms identified through genome-wide association studies and their associations with type 2 diabetes in Chinese, Malays, and Asian-Indians in Singapore.
19845562 2011 Analysis of complement factor H Y402H, LOC387715, HTRA1 polymorphisms and ApoE alleles with susceptibility to age-related macular degeneration in Hungarian patients.
19823576 2009 CFH, C3 and ARMS2 are significant risk loci for susceptibility but not for disease progression of geographic atrophy due to AMD.
19822855 2009 Typing of ARMS2 and CFH in age-related macular degeneration: case-control study and assessment of frequency in the Italian population.
19797206 2010 Susceptibility genes and progression in age-related maculopathy: a study of single eyes.
19796758 2009 Comprehensive analysis of complement factor H and LOC387715/ARMS2/HTRA1 variants with respect to phenotype in advanced age-related macular degeneration.
19680273 2010 ARMS2/HTRA1 and CFH polymorphisms are not associated with choroidal neovascularization in highly myopic eyes of the elderly Japanese population.
19661236 2009 Plasma complement components and activation fragments: associations with age-related macular degeneration genotypes and phenotypes.
19568762 2009 Complement factor H and LOC387715 gene polymorphisms in a Greek population with age-related macular degeneration.
19491722 Analyses of single nucleotide polymorphisms and haplotype linkage of LOC387715 and the HTRA1 gene in exudative age-related macular degeneration in a Chinese cohort.
19268887 2009 ARMS2 (LOC387715) variants in Japanese patients with exudative age-related macular degeneration and polypoidal choroidal vasculopathy.
19259132 2009 Multilocus analysis of age-related macular degeneration.
19255159 2009 Localization of age-related macular degeneration-associated ARMS2 in cytosol, not mitochondria.
19202148 2009 Assessing susceptibility to age-related macular degeneration with proteomic and genomic biomarkers.
19197355 2009 Interpretation of genetic association studies: markers with replicated highly significant odds ratios may be poor classifiers.
19169232 2009 Variations in five genes and the severity of age-related macular degeneration: results from the Muenster aging and retina study.
19168221 2009 Complement component C3 and risk of age-related macular degeneration.
19117936 2009 Prediction model for prevalence and incidence of advanced age-related macular degeneration based on genetic, demographic, and environmental variables.
19065273 2008 Sequence variants in HTRA1 and LOC387715/ARMS2 and phenotype and response to photodynamic therapy in neovascular age-related macular degeneration in populations from Israel.
19048105 2008 Multifactor effects and evidence of potential interaction between complement factor H Y402H and LOC387715 A69S in age-related macular degeneration.
19001225 2008 Analysis of major alleles associated with age-related macular degeneration in patients with multifocal choroiditis: strong association with complement factor H.
18936151 2009 Peripheral retinal drusen and reticular pigment: association with CFHY402H and CFHrs1410996 genotypes in family and twin studies.
18855541 2008 CFH and LOC387715/ARMS2 genotypes and antioxidants and zinc therapy for age-related macular degeneration.
18762075 2008 Myopic choroidal neovascularization genetics.
18688167 2008 Polymorphisms in the LOC387715/ARMS2 putative gene and the risk for Alzheimer's disease.
18682812 2008 Association of CFH, LOC387715, and HTRA1 polymorphisms with exudative age-related macular degeneration in a northern Chinese population.
18682806 2008 Joint effects of polymorphisms in the HTRA1, LOC387715/ARMS2, and CFH genes on AMD in a Caucasian population.
18569809 LOC387715, smoking and their prognostic impact on visual functional status in age-related macular degeneration-The Muenster Aging and Retina Study (MARS) cohort.
18544707 2008 Extension of type 2 diabetes genome-wide association scan results in the diabetes prevention program.
18515590 2008 Association analysis of CFH, C2, BF, and HTRA1 gene polymorphisms in Chinese patients with polypoidal choroidal vasculopathy.
18511946 2008 Age-related macular degeneration is associated with an unstable ARMS2 (LOC387715) mRNA.
18493315 2008 C2 and CFB genes in age-related maculopathy and joint action with CFH and LOC387715 genes.
18461138 2008 Mitochondrial DNA polymorphism A4917G is independently associated with age-related macular degeneration.
18452766 2008 Age-related macular degeneration genetics.
18436811 2008 Variants in the 10q26 gene cluster (LOC387715 and HTRA1) exhibit enhanced risk of age-related macular degeneration along with CFH in Indian patients.
18423869 2008 CFH and LOC387715/ARMS2 genotypes and treatment with antioxidants and zinc for age-related macular degeneration.
18400199 2008 Association of LOC387715 A69S with vitreous hemorrhage in polypoidal choroidal vasculopathy.
18325906 2008 C3 R102G polymorphism increases risk of age-related macular degeneration.
18292785 2009 Association of complement factor H and LOC387715 genotypes with response of exudative age-related macular degeneration to photodynamic therapy.
18248681 2008 Prevalence of common disease-associated variants in Asian Indians.
18164066 2008 Alleles in the HtrA serine peptidase 1 gene alter the risk of neovascular age-related macular degeneration.
18162041 2007 Neovascular age-related macular degeneration risk based on CFH, LOC387715/HTRA1, and smoking.
18161619 2007 LOC387715/HTRA1 and complement factor H variants in patients with age-related macular degeneration seen at the mayo clinic.
18079691 2007 PLEKHA1-LOC387715-HTRA1 polymorphisms and exudative age-related macular degeneration in the French population.
18061132 2008 Phenotype analysis of patients with the risk variant LOC387715 (A69S) in age-related macular degeneration.
18054635 2007 Association of complement factor H and LOC387715 genotypes with response of exudative age-related macular degeneration to intravitreal bevacizumab.
17884985 2007 A variant of mitochondrial protein LOC387715/ARMS2, not HTRA1, is strongly associated with age-related macular degeneration.
17846368 2007 Macular degeneration: risk factors for progression.
17692272 2007 LOC387715/HTRA1 variants in polypoidal choroidal vasculopathy and age-related macular degeneration in a Japanese population.
17675241 2008 The LOC387715 polymorphism, inflammatory markers, smoking, and age-related macular degeneration. A population-based case-control study.
17485225 2007 Expression of recombinant protein encoded by LOC387715 in Escherichia coli.
17456821 2007 Association of CFH Y402H and LOC387715 A69S with progression of age-related macular degeneration.
17426452 2007 HTRA1 variant confers similar risks to geographic atrophy and neovascular age-related macular degeneration.
17352366 2007 Relationship between age-related macular degeneration-associated variants of complement factor H and LOC387715 with coronary artery disease.
17347568 2007 The LOC387715 gene, smoking, body mass index, environmental associations with advanced age-related macular degeneration.
17325155 2007 The LOC387715 polymorphism and age-related macular degeneration: replication in three case-control samples.
17285240 2007 Assessment of the contribution of the LOC387715 gene polymorphism in a family with exudative age-related macular degeneration and heterozygous CFH variant (Y402H).
17210852 2007 A prospective study of 2 major age-related macular degeneration susceptibility alleles and interactions with modifiable risk factors.
17194541 2007 A polymorphism of LOC387715 gene is associated with age-related macular degeneration in the Japanese population.
17053108 2006 HTRA1 promoter polymorphism in wet age-related macular degeneration.
17000705 2006 CFH, ELOVL4, PLEKHA1 and LOC387715 genes and susceptibility to age-related maculopathy: AREDS and CHS cohorts and meta-analyses.
16954704 2006 Further support for the common variants in complement factor H (Y402H) and LOC387715 (A69S) genes as major risk factors for the exudative age-related macular degeneration.
16936732 2006 Common variation in three genes, including a noncoding variant in CFH, strongly influences risk of age-related macular degeneration.
16642439 2006 Cigarette smoking strongly modifies the association of LOC387715 and age-related macular degeneration.
16174643 2005 Hypothetical LOC387715 is a second major susceptibility gene for age-related macular degeneration, contributing independently of complement factor H to disease risk.
16080115 2005 Susceptibility genes for age-related maculopathy on chromosome 10q26.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.