Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy 1.793 4.3e-07
adult high grade glioma -1.100 1.2e-02
astrocytic glioma 2.000 4.6e-03
atypical teratoid / rhabdoid tumor -1.400 6.3e-03
Breast cancer -1.900 6.4e-12
ependymoma -1.500 9.1e-04
glioblastoma -1.600 5.1e-04
invasive ductal carcinoma -1.100 6.2e-04
juvenile dermatomyositis 1.077 1.6e-08
lung carcinoma 1.100 8.6e-15
medulloblastoma -1.100 1.3e-02
medulloblastoma, large-cell -1.800 6.4e-03
oligodendroglioma 1.900 9.3e-03
osteosarcoma 1.968 1.3e-07
ovarian cancer -1.900 7.8e-15
subependymal giant cell astrocytoma -1.636 5.2e-03

AA Sequence

MSAAGLKITGSKETKRRLLLISIDWSRDLMNLCIYFRVYCQEKQEERRELPRIITGPPPEAAVVAFEWLK      1 - 70
TSTLTGLHPQLPLSLPQPECALPYLVRAFSRGDYMGRIQEVGWVTAGLVIWAGTCYYIYKFTKGRAQSVR     71 - 140
TLARNGSTVKMETVVGVQSQTLAINEAEIKTKPQVEIGAETGARSGPRAEVETKATAIAIHRANSQAKAM    141 - 210
VGAEPETQSESKVVAGTLVMTEAVTLTEVKAKAREVAMKEAVTQTDAEAGKIVKKEAVTQTKAKAWALVA    211 - 280
KTEAKREAMTQTKAETHILAEKETEINRVMVTQSETLAVPREVAKMGATNKTGIVDETKTRALEETVLIP    281 - 350
RAFPSKNASC                                                                351 - 360
//

Text Mined References (10)

PMID Year Title