Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.28
PubTator Score 3.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
pancreatic cancer 1.200 5.3e-04
esophageal adenocarcinoma 1.200 3.0e-02
osteosarcoma 1.093 9.4e-03
medulloblastoma, large-cell -1.900 6.4e-04
juvenile dermatomyositis 1.662 5.0e-10
tuberculosis and treatment for 6 months -1.700 6.6e-06
active Crohn's disease 1.607 3.3e-03
group 3 medulloblastoma -1.400 1.9e-02
pancreatic carcinoma 1.200 5.3e-04
subependymal giant cell astrocytoma 1.346 2.6e-02
lung adenocarcinoma 1.104 2.6e-04
psoriasis -1.200 6.6e-09
ulcerative colitis 1.900 3.2e-08
ovarian cancer 2.500 6.4e-05
dermatomyositis 1.300 1.2e-02

Synonym

Accession Q9UH62 Q53HC6 Q7LCF5 Q9NPE4
Symbols ALEX3
GASP6
dJ545K15.2

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (1)

PMID Text
23844091 The Wnt pathway regulates mitochondrial distribution and dynamics through Alex3 protein degradation.

AA Sequence

MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGSGDVDDAGDCSGARYNDWSDDDDDSNES      1 - 70
KSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILE     71 - 140
AALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDD    141 - 210
TITSRLNSSVQLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTREL    211 - 280
LRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGI    281 - 350
ESHHDFLVKVKVGKFMAKLAEHMFPKSQE                                             351 - 379
//

Text Mined References (20)

PMID Year Title
23844091 2013 The non-canonical Wnt/PKC pathway regulates mitochondrial dynamics through degradation of the arm-like domain-containing protein Alex3.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22569362 2012 The Eutherian Armcx genes regulate mitochondrial trafficking in neurons and interact with Miro and Trak2.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19304657 2009 The armadillo repeat-containing protein, ARMCX3, physically and functionally interacts with the developmental regulatory factor Sox10.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16221301 2005 Mammalian BEX, WEX and GASP genes: coding and non-coding chimaerism sustained by gene conversion events.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
11162520 2001 ALEX1, a novel human armadillo repeat protein that is expressed differentially in normal tissues and carcinomas.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.