Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.77
PubTator Score 5.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ependymoma 4679 9.8e-13
nasopharyngeal carcinoma 1058 2.6e-07
psoriasis 6694 9.2e-05
lung carcinoma 2843 7.6e-04
chronic rhinosinusitis 512 3.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Asperger syndrome 37 3.815 1.9

Expression

  Differential Expression (5)

Disease log2 FC p
chronic rhinosinusitis -1.937 3.3e-02
ependymoma 4.400 9.8e-13
lung carcinoma -1.500 7.6e-04
nasopharyngeal carcinoma -2.100 2.6e-07
psoriasis -1.700 9.2e-05

Gene RIF (4)

AA Sequence

MGKKIKKEVEPPPKDVFDPLMIESKKAATVVLMLNSPEEEILAKACEAIYKFALKGEENKTTLLELGAVE      1 - 70
PLTKLLTHEDKIVRRNATMIFGILASNNDVKKLLRELDVMNSVIAQLAPEEEVVIHEFASLCLANMSAEY     71 - 140
TSKVQIFEHGGLEPLIRLLSSPDPDVKKNSMECIYNLVQDFQCRAKLQELNAIPPILDLLKSEYPVIQLL    141 - 210
ALKTLGVIANDKESRTMLRDNQGLDHLIKILETKELNDLHIEALAVIANCLEDMDTMVQIQQTGGLKKLL    211 - 280
SFAENSTIPDIQKNAAKAITKAAYDPENRKLFHEQEVEKCLVALLGSENDGTKIAASQAISAMCENSGSK    281 - 350
DFFNNQGIPQLIQLLKSDNEEVREAAALALANLTTCNPANANAAAEADGIDPLINLLSSKRDGAIANAAT    351 - 420
VLTNMAMQEPLRLNIQNHDIMHAIISPLRSANTVVQSKAALAVTATACDVEARTELRNSGGLEPLVELLR    421 - 490
SKNDEVRKHASWAVMVCAGDELTANELCRLGALDILEEVNVSGTRKNKFSEAAYNKLLNNNLSLKYSQTG    491 - 560
YLSSSNIINDGFYDYGRINPGTKLLPLKELCLQEPSDLRAVLLINSKSYVSPPSSMEDKSDVGYGRSISS    561 - 630
SSSLRRSSKEKNKKNSYHFSAGFGSPIEDKSEPASGRNTVLSKSATKEKGWRKSKGKKEEEKVKEEEEVM    631 - 700
VVPKFVGEGSSDKEWCPPSDPDFSMYVYEVTKSILPITNIKEQIEDLAKYVAEKMGGKIPKEKLPDFSWE    701 - 770
LHISELKFQLKSNVIPIGHVKKGIFYHRALLFKALADRIGIGCSLVRGEYGRAWNEVMLQNDSRKGVIGG    771 - 840
LPAPEMYVIDLMFHPGGLMKLRSREADLYRFI                                          841 - 872
//

Text Mined References (11)

PMID Year Title