Property Summary

NCBI Gene PubMed Count 10
PubMed Score 53.92
PubTator Score 4.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma 1.100 3.3e-04
ovarian cancer 1.200 1.5e-03
pancreatic cancer 1.100 1.1e-03
pancreatic carcinoma 1.100 1.1e-03

Gene RIF (3)

AA Sequence

MGGPRGAGWVAAGLLLGAGACYCIYRLTRGRRRGDRELGIRSSKSAGALEEGTSEGQLCGRSARPQTGGT      1 - 70
WESQWSKTSQPEDLTDGSYDDVLNAEQLQKLLYLLESTEDPVIIERALITLGNNAAFSVNQAIIRELGGI     71 - 140
PIVANKINHSNQSIKEKALNALNNLSVNVENQIKIKIYISQVCEDVFSGPLNSAVQLAGLTLLTNMTVTN    141 - 210
DHQHMLHSYITDLFQVLLTGNGNTKVQVLKLLLNLSENPAMTEGLLRAQVDSSFLSLYDSHVAKEILLRV    211 - 280
LTLFQNIKNCLKIEGHLAVQPTFTEGSLFFLLHGEECAQKIRALVDHHDAEVKEKVVTIIPKI           281 - 343
//

Text Mined References (20)

PMID Year Title