Property Summary

NCBI Gene PubMed Count 20
PubMed Score 11.96
PubTator Score 7.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.600 3.1e-09
Breast cancer 1.100 2.7e-09
breast carcinoma 1.200 1.1e-17
dermatomyositis 1.100 1.2e-03
glioblastoma -1.200 3.9e-06
group 4 medulloblastoma -1.200 1.7e-04
invasive ductal carcinoma 1.200 4.1e-04
medulloblastoma, large-cell -2.100 4.5e-06
Multiple myeloma 1.648 3.4e-03
ovarian cancer -1.600 1.2e-06
pancreatic cancer 1.200 8.5e-03
pancreatic ductal adenocarcinoma liver m... -1.273 1.4e-02
Pick disease -1.200 2.3e-05
primitive neuroectodermal tumor -1.300 1.9e-04
tuberculosis -1.200 7.2e-06
Waldenstrons macroglobulinemia 1.153 2.9e-02

Gene RIF (11)

AA Sequence

MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIW      1 - 70
DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDE     71 - 140
KQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS                            141 - 186
//

Text Mined References (27)

PMID Year Title