Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.00
PubTator Score 0.50

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 1.6e-06


  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.640 1.6e-06

AA Sequence

FLTLSTIKDHSWHIQGCCALTREGLPARLQWMESQAAAN                                   141 - 179

Text Mined References (2)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
11181995 2001 The sequence of the human genome.