Property Summary

NCBI Gene PubMed Count 13
PubMed Score 15.42
PubTator Score 13.76

Knowledge Summary


No data available


  Disease (4)


  Differential Expression (13)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 7.7e-05
Breast cancer 4.100 2.4e-02
diabetes mellitus -1.100 2.4e-02
glioblastoma 1.300 4.8e-04
group 3 medulloblastoma 1.100 8.2e-03
intraductal papillary-mucinous carcinoma... 1.200 2.0e-02
medulloblastoma, large-cell 2.000 4.1e-05
pediatric high grade glioma 1.100 2.9e-04
pituitary cancer -1.100 1.9e-04
psoriasis 1.400 1.3e-46
spina bifida -1.299 3.3e-02
tuberculosis -1.500 3.4e-04
ulcerative colitis 1.100 3.6e-07

Gene RIF (7)

AA Sequence

YLTLSSIKDHPWHIQSCCALTGEGLCQGLEWMTSRIGVR                                   141 - 179

Text Mined References (13)

PMID Year Title