Property Summary

NCBI Gene PubMed Count 11
PubMed Score 14.30
PubTator Score 13.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
group 4 medulloblastoma 2.200 2.0e-08
atypical teratoid / rhabdoid tumor 1.400 7.7e-05
glioblastoma 1.300 4.8e-04
medulloblastoma, large-cell 2.000 4.1e-05
tuberculosis -1.500 3.4e-04
intraductal papillary-mucinous carcinoma... 1.200 2.0e-02
diabetes mellitus -1.100 2.4e-02
Breast cancer 4.100 2.4e-02
pediatric high grade glioma 1.100 2.9e-04
spina bifida -1.299 3.3e-02
ulcerative colitis 1.200 1.8e-04
pituitary cancer -1.100 1.9e-04
psoriasis 1.400 1.3e-46

Synonym

Accession Q96KC2
Symbols ARL8

Gene

PDB

1YZG  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 GO Component (1)

 Compartment GO Term (1)

Gene RIF (6)

PMID Text
25496667 Genome-wide shRNA screening identifies ARL5B, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
22245584 Arl5b is a trans-golgi-network-localised small G protein that plays a key role in regulating transport along the endosome-trans-golgi network pathway
22172677 Arl8 and SKIP are required for lysosomes to distribute away from the microtubule-organizing center. We identify two kinesin light chain binding motifs in SKIP that are required for lysosomes to accumulate kinesin-1 and redistribute to the cell periphery.
20932310 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)
12853149 ARL8 contains six exons and five introns, and encodes a 179 amino acid protein that shares homology to the other ARL proteins.

AA Sequence

MGLIFAKLWSLFCNQEHKVIIVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEIVVKNTHFLMWDIGGQ      1 - 70
ESLRSSWNTYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMKGCMTAAEISK     71 - 140
YLTLSSIKDHPWHIQSCCALTGEGLCQGLEWMTSRIGVR                                   141 - 179
//

Text Mined References (11)

PMID Year Title
22245584 2012 Arl5b is a Golgi-localised small G protein involved in the regulation of retrograde transport.
22172677 2011 Arl8 and SKIP act together to link lysosomes to kinesin-1.
21658281 2011 GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease.
20932310 2010 Genome-wide association reveals genetic effects on human A?42 and ? protein levels in cerebrospinal fluids: a case control study.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853149 2003 Isolation of a new member of the ADP-ribosylation like factor gene family, ARL8, from a cartilage cDNA library.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.