Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.45
PubTator Score 6.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -2.100 3.4e-07
esophageal adenocarcinoma -1.100 1.8e-02
psoriasis 1.300 8.2e-04
osteosarcoma 3.078 9.6e-06
astrocytoma -1.100 9.2e-03
group 3 medulloblastoma 2.200 1.5e-04
lung adenocarcinoma -1.300 2.3e-07
ovarian cancer -1.600 3.4e-06

Protein-protein Interaction (4)

Gene RIF (3)

PMID Text
22927989 a portion of endogenous ARL4D and the GTP-binding-defective ARL4D mutant ARL4D(T35N) reside in the mitochondria
17398095 Study shows that three related Arf-like GTPases Arl4a, Arl4c, and Arl4d, are able to recruit ARNO and other cytohesins to the plasma membrane by binding to their PH domains irrespective of whether they are in the diglycine or triglycine form.
12472661 ARF4L 15-24 and ARF4L 69-77, possessed the ability to induce HLA-A2-restricted and tumor-reactive CTLs from peripheral blood mononuclear cells of patients with brain tumors

AA Sequence

MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGI      1 - 70
TFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQP     71 - 140
GALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQQGLERLYEMILKRKKAARGGKKRR             141 - 201
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22927989 2012 GTP-binding-defective ARL4D alters mitochondrial morphology and membrane potential.
17398095 2007 The Arl4 family of small G proteins can recruit the cytohesin Arf6 exchange factors to the plasma membrane.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15314642 2004 Mutations in a member of the Ras superfamily of small GTP-binding proteins causes Bardet-Biedl syndrome.
15258860 2004 Comparative genomic analysis identifies an ADP-ribosylation factor-like gene as the cause of Bardet-Biedl syndrome (BBS3).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12472661 2002 Recognition of ADP-ribosylation factor 4-like by HLA-A2-restricted and tumor-reactive cytotoxic T lymphocytes from patients with brain tumors.
10831612 2000 ADP ribosylation factor-like protein 2 (Arl2) regulates the interaction of tubulin-folding cofactor D with native tubulin.
10508919 1999 A novel ADP-ribosylation like factor (ARL-6), interacts with the protein-conducting channel SEC61beta subunit.
10462049 1999 ADP-ribosylation factor (ARF)-like 4, 6, and 7 represent a subgroup of the ARF family characterization by rapid nucleotide exchange and a nuclear localization signal.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7590735 1995 Isolation and mapping of a gene encoding a novel human ADP-ribosylation factor on chromosome 17q12-q21.
7581362 1995 Comparison of the positional cloning methods used to isolate the BRCA1 gene.
7545954 1994 A strong candidate for the breast and ovarian cancer susceptibility gene BRCA1.