Property Summary

NCBI Gene PubMed Count 12
PubMed Score 10.49
PubTator Score 26.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
chronic lymphocytic leukemia 1.178 2.2e-02
urothelial carcinoma -1.500 1.5e-02
malignant mesothelioma -2.300 2.3e-06
cutaneous lupus erythematosus 1.300 1.2e-02
psoriasis 1.700 1.3e-04
osteosarcoma 2.132 4.1e-03
cystic fibrosis 1.400 8.9e-04
glioblastoma 1.900 1.8e-02
group 4 medulloblastoma -2.700 1.2e-06
medulloblastoma, large-cell -2.600 1.5e-03
chronic kidney disease 2.300 6.6e-03
primary pancreatic ductal adenocarcinoma 1.982 2.9e-03
non-small cell lung cancer 1.094 1.4e-09
intraductal papillary-mucinous carcinoma... -1.900 3.2e-02
pancreatic cancer 1.800 5.0e-03
posterior fossa group A ependymoma 1.100 2.2e-05
Endometriosis -1.213 2.1e-02
Breast cancer -3.300 3.7e-19
lung carcinoma -1.100 1.4e-14
spina bifida -1.175 1.7e-02
gastric carcinoma 1.500 2.8e-02
ulcerative colitis 2.400 8.9e-06
ovarian cancer 4.100 3.2e-07
pituitary cancer -1.600 2.4e-04

Gene RIF (4)

PMID Text
25486429 Arl4c is involved in tumorigenesis and might represent a novel therapeutic target for suppressing proliferation and invasion of colorectal and lung cancer cells.
21187453 an important role of LXRs in the coordinated regulation of lipid metabolic and inflammatory gene programs in macrophages
19409876 ARL7 might modulate the intracellular vesicular transport via interaction with microtubules.
17398095 Study shows that three related Arf-like GTPases Arl4a, Arl4c, and Arl4d, are able to recruit ARNO and other cytohesins to the plasma membrane by binding to their PH domains irrespective of whether they are in the diglycine or triglycine form.

AA Sequence

MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVG      1 - 70
GQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEI     71 - 140
EKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKR                      141 - 192
//

Text Mined References (14)

PMID Year Title
25486429 2015 Arl4c expression in colorectal and lung cancers promotes tumorigenesis and may represent a novel therapeutic target.
24165912 2013 Genome-wide association study identifies 8 novel loci associated with blood pressure responses to interventions in Han Chinese.
21187453 2011 Constitutive activation of LXR in macrophages regulates metabolic and inflammatory gene expression: identification of ARL7 as a direct target.
20686608 2010 Genome-wide association study of pancreatic cancer in Japanese population.
19409876 2009 ADP-ribosylation factor like 7 (ARL7) interacts with alpha-tubulin and modulates intracellular vesicular transport.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17398095 2007 The Arl4 family of small G proteins can recruit the cytohesin Arf6 exchange factors to the plasma membrane.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15147902 2004 ADP-ribosylation factor (ARF)-like 7 (ARL7) is induced by cholesterol loading and participates in apolipoprotein AI-dependent cholesterol export.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10462049 1999 ADP-ribosylation factor (ARF)-like 4, 6, and 7 represent a subgroup of the ARF family characterization by rapid nucleotide exchange and a nuclear localization signal.