Property Summary

NCBI Gene PubMed Count 32
PubMed Score 30.93
PubTator Score 24.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (1)

Disease log2 FC p
group 4 medulloblastoma -1.200 9.7e-05

Gene RIF (12)

PMID Text
24911211 We hypothesize that ARL2 plays essential roles inside mitochondria along with other cellular functions, at least in part to provide coupling of regulation between these essential cell processes.
23807224 MiR-195 regulates cell apoptosis in a context-dependent manner through directly targeting ARL2.
22002721 The G proteins Arl2 acts in a GTP-dependent manner as allosteric release factors for farnesylated cargo.
21199864 a novel function of miR-16 targeting ARL2 in modulating proliferation and cell cycle progression.
20740604 Data show that bovine and human TBCD have functionally identical roles in tubulin heterodimer assembly, and that the inability of human TBCD to disrupt microtubule integrity can be overcome by siRNA-mediated suppression of expression of Arl2.
19368893 Crystal structure of the ARL2-GTP-BART complex reveals a novel recognition and binding mode of small GTPase with effector.
18818514 Arl2 could, via protein phosphatase 2A , influence p53 phosphorylation status.
18588884 Arl2 and Arl3 interactions were characterized.
17704193 ARL2 and beta-tubulin cofactor D participate in AJC disassembly and epithelial depolarization
17188265 In summary, alterations in Arl2 protein content were found to be associated with modifications in tubulin pools, microtubule dynamics as well as cell cycle progression.
16525022 Arl2 is present in centrosomes and propose that its action in regulating tubulin polymerization is mediated at centrosomes
12015966 C. elegans evl-20 gene encodes a functional homolog of human ARL2. Elimination of evl-20 function results in abnormal vulval, gonad, and male tail development and disrupts embryonic proliferation, hypodermal enclosure, and elongation.

AA Sequence

MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQ      1 - 70
KSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIRE     71 - 140
VLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD                              141 - 184
//

Text Mined References (38)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
24911211 2014 The ARL2 GTPase is required for mitochondrial morphology, motility, and maintenance of ATP levels.
23807224 2013 MicroRNA-195 targets ADP-ribosylation factor-like protein 2 to induce apoptosis in human embryonic stem cell-derived neural progenitor cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22002721 2011 Arl2-GTP and Arl3-GTP regulate a GDI-like transport system for farnesylated cargo.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
21199864 2011 A microarray-based approach identifies ADP ribosylation factor-like protein 2 as a target of microRNA-16.
20740604 2010 Effect of TBCD and its regulatory interactor Arl2 on tubulin and microtubule integrity.
19368893 2009 Crystal structure of the ARL2-GTP-BART complex reveals a novel recognition and binding mode of small GTPase with effector.
18981177 2009 The structure of binder of Arl2 (BART) reveals a novel G protein binding domain: implications for function.
18818514 2008 Expression of Arl2 is associated with p53 localization and chemosensitivity in a breast cancer cell line.
18588884 2008 Specificity of Arl2/Arl3 signaling is mediated by a ternary Arl3-effector-GAP complex.
18234692 2008 BART is essential for nuclear retention of STAT3.
17704193 2008 Beta-tubulin cofactor D and ARL2 take part in apical junctional complex disassembly and abrogate epithelial structure.
17646400 2007 Functional dissection of Rab GTPases involved in primary cilium formation.
17452337 2007 ELMOD2 is an Arl2 GTPase-activating protein that also acts on Arfs.
17188265 2007 ADP ribosylation factor like 2 (Arl2) protein influences microtubule dynamics in breast cancer cells.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16525022 2006 Arl2 and Arl3 regulate different microtubule-dependent processes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12912990 2003 Cytosolic Arl2 is complexed with cofactor D and protein phosphatase 2A.
12527357 2003 Photoreceptor synaptic protein HRG4 (UNC119) interacts with ARL2 via a putative conserved domain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11980706 2002 The complex of Arl2-GTP and PDE delta: from structure to function.
11847227 2002 Functional overlap between retinitis pigmentosa 2 protein and the tubulin-specific chaperone cofactor C.
11809823 2002 ARL2 and BART enter mitochondria and bind the adenine nucleotide transporter.
11303027 2001 ADP-ribosylation factors (ARFs) and ARF-like 1 (ARL1) have both specific and shared effectors: characterizing ARL1-binding proteins.
10831612 2000 ADP ribosylation factor-like protein 2 (Arl2) regulates the interaction of tubulin-folding cofactor D with native tubulin.
10488091 1999 The ARF-like 2 (ARL2)-binding protein, BART. Purification, cloning, and initial characterization.
9253601 1997 A transcript map for the 2.8-Mb region containing the multiple endocrine neoplasia type 1 locus.
8415637 1993 Selective amplification of additional members of the ADP-ribosylation factor (ARF) family: cloning of additional human and Drosophila ARF-like genes.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.