Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.41
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q0P5N6
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MRVAGGRALSRGAELRVPGGAKHGMCLLLGATGVGKTLLVKRLQEVSSRDGKGDLGEPPPTRPTVGTNLT      1 - 70
DIVAQRKITIRELGGCMGPIWSSYYGNCRSLLFVMDASDPTQLSASCVQLLGLLSAEQLAEASVLILFNK     71 - 140
IDLPCYMSTEEMKSLIRLPDIIACAKQNITTAEISAREGTGLAGVLAWLQATHRAND                 141 - 197
//

Text Mined References (7)

PMID Year Title