Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.41
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MRVAGGRALSRGAELRVPGGAKHGMCLLLGATGVGKTLLVKRLQEVSSRDGKGDLGEPPPTRPTVGTNLT      1 - 70
DIVAQRKITIRELGGCMGPIWSSYYGNCRSLLFVMDASDPTQLSASCVQLLGLLSAEQLAEASVLILFNK     71 - 140
IDLPCYMSTEEMKSLIRLPDIIACAKQNITTAEISAREGTGLAGVLAWLQATHRAND                 141 - 197
//

Text Mined References (7)

PMID Year Title