Property Summary

NCBI Gene PubMed Count 20
PubMed Score 9.53
PubTator Score 6.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Rheumatoid Arthritis 1.400 9.1e-03
malignant mesothelioma -1.600 3.8e-07
astrocytic glioma -1.200 1.3e-03
psoriasis -1.800 1.4e-04
ependymoma -1.200 7.3e-04
atypical teratoid / rhabdoid tumor -2.200 1.5e-05
glioblastoma -2.000 1.5e-04
medulloblastoma -1.700 1.9e-02
medulloblastoma, large-cell -2.700 3.2e-04
primitive neuroectodermal tumor -1.400 2.9e-02
Duchenne muscular dystrophy 1.225 1.8e-06
juvenile dermatomyositis 1.060 8.6e-08
primary pancreatic ductal adenocarcinoma 1.749 2.9e-03
adult high grade glioma -1.400 1.4e-02
subependymal giant cell astrocytoma 1.858 1.1e-02
ovarian cancer -1.500 5.0e-08
pancreatic cancer 1.600 6.2e-03

Synonym

Accession Q9NXU5 Q6IAD0
Symbols ARFRP2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

PMID Text
26722494 These findings indicated that there may be a racial/ethnic- and/or sex-specific association of the ARL15 rs6450176 single nucleotide polymorphism and serum lipid levels.
24688318 The SNPs in ADP-ribosylation factor-like protein 15 (ARL15) and the T-cadherin (CDH13) genes did not exhibit significant association with individual metabolic traits in the T2DM and NDM groups.
23918589 In this first GWAS of rheumatoid arthritis among North Indians, ARL15 emerged as a novel genetic risk factor in addition to the classic HLA locus.
20950786 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20011104 findings identify a novel protein, ARL15, which influences circulating adiponectin levels and may impact upon CHD risk
20011104 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MSDLRITEAFLYMDYLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKA      1 - 70
VPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHPQLCTLPFLIL     71 - 140
ANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDMDALKDSFSQLINLLEEKDHEAVRM          141 - 204
//

Text Mined References (21)

PMID Year Title
26722494 2015 Association of the ARL15 rs6450176 SNP and serum lipid levels in the Jing and Han populations.
24962325 2014 Genome-wide survival analysis of age at onset of alcohol dependence in extended high-risk COGA families.
24688318 2014 Association study of ARL15 and CDH13 with T2DM in a Han Chinese population.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23918589 2013 A genome-wide association study reveals ARL15, a novel non-HLA susceptibility gene for rheumatoid arthritis in North Indians.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22479202 2012 Novel loci for adiponectin levels and their influence on type 2 diabetes and metabolic traits: a multi-ethnic meta-analysis of 45,891 individuals.
21269460 2011 Initial characterization of the human central proteome.
20950786 2010 A genome-wide study reveals copy number variants exclusive to childhood obesity cases.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20011104 2009 A genome-wide association study reveals variants in ARL15 that influence adiponectin levels.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.