Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Synonym

Accession Q8N7S6
Symbols C3orf71

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MLGQRAGDGERPGLPGDGEGGVPARPGRRAERPPQRPAKVNKAVTCAAHLPGAAASRPLSPNKPDRVRPG      1 - 70
QRDRIGAKRQRRRRADAGQARAASSRRVVPTAPEVLGAVASLPDRGRPTVARVATGSRLEGLFSAASLKL     71 - 140
SALTQSLTRVRQAPTASGATIRLPASPVEMFLTSAFLTGFSFHCLYSGIGHGEDILASVEQITIVSRPLS    141 - 210
GQRGAGPGNSAYTPRRSQGGPRAATTPGFRFPCRGLVRRAVLRLTVTVQDCILTALLAVSFHSIGVVIMT    211 - 280
SSYLLGPVVK                                                                281 - 290
//

Text Mined References (3)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.