Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.100 7.7e-04
osteosarcoma -1.110 5.4e-04
posterior fossa group B ependymoma 1.100 7.0e-04

Synonym

Accession Q8N7S6
Symbols C3orf71

Gene

  Ortholog (1)

Species Source Disease
OMA EggNOG

AA Sequence

MLGQRAGDGERPGLPGDGEGGVPARPGRRAERPPQRPAKVNKAVTCAAHLPGAAASRPLSPNKPDRVRPG      1 - 70
QRDRIGAKRQRRRRADAGQARAASSRRVVPTAPEVLGAVASLPDRGRPTVARVATGSRLEGLFSAASLKL     71 - 140
SALTQSLTRVRQAPTASGATIRLPASPVEMFLTSAFLTGFSFHCLYSGIGHGEDILASVEQITIVSRPLS    141 - 210
GQRGAGPGNSAYTPRRSQGGPRAATTPGFRFPCRGLVRRAVLRLTVTVQDCILTALLAVSFHSIGVVIMT    211 - 280
SSYLLGPVVK                                                                281 - 290
//

Text Mined References (3)

PMID Year Title