Property Summary

NCBI Gene PubMed Count 23
PubMed Score 26.36
PubTator Score 20.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.483 4.8e-04
intraductal papillary-mucinous neoplasm ... 1.100 1.9e-02
lung cancer 1.200 6.5e-04
group 3 medulloblastoma 1.100 2.4e-03
Pick disease -1.300 2.8e-07
ovarian cancer -1.400 5.3e-06

Gene RIF (9)

PMID Text
24486325 We show that ARIH2 E3-ligase regulates PABPN1 protein accumulation and aggregation
24076655 TRIAD1 and HHARI bind to and are activated by distinct neddylated Cullin-RING ligase complexes.
22940738 study demonstrated that TRIAD1 is a ubiquitination target for proteasome-dependent degradation by MDM2; results suggest TRIAD1 degradation by MDM2 suppresses TRIAD1-mediated cell growth; data suggested a novel negative regulatory mechanism of TRIAD1 via MDM2 E3 ligase ubiquitination
22819825 TRIAD1 as a novel modulator of the p53-MDM2 axis that induces p53 activation by inhibiting its regulation by MDM2.
22037423 In sharp contrast to SIAH1/SIAH2 and UBCH8, TRIAD1 binding to PML-RARalpha has no effect on its turnover.
21454682 HoxA10 influences protein ubiquitination by activating transcription of ARIH2, the gene encoding Triad1
19340006 Triad1 has dual ubiquitin ligase activity; both its RING domains are crucial for inhibiting myeloid proliferation. The N-terminal RING finger (RING1) of Triad1 binds UbcH7; the C-terminal RING finger (RING2) binds Ubc13.
17646546 The fine-tuning of Gfi1 protein levels regulated by Triad1 defines an unexpected role for this protein in hematopoiesis.
16118314 proteasomal degradation of proteins that are ubiquitinated by Triad1 affects the clonogenic growth of primary myeloid progenitor cells

AA Sequence

MSVDMNSQGSDSNEEDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQGADAFDPEEYQFTCLTYKESE      1 - 70
GALNEHMTSLASVLKVSHSVAKLILVNFHWQVSEILDRYKSNSAQLLVEARVQPNPSKHVPTSHPPHHCA     71 - 140
VCMQFVRKENLLSLACQHQFCRSCWEQHCSVLVKDGVGVGVSCMAQDCPLRTPEDFVFPLLPNEELREKY    141 - 210
RRYLFRDYVESHYQLQLCPGADCPMVIRVQEPRARRVQCNRCNEVFCFKCRQMYHAPTDCATIRKWLTKC    211 - 280
ADDSETANYISAHTKDCPKCNICIEKNGGCNHMQCSKCKHDFCWMCLGDWKTHGSEYYECSRYKENPDIV    281 - 350
NQSQQAQAREALKKYLFYFERWENHNKSLQLEAQTYQRIHEKIQERVMNNLGTWIDWQYLQNAAKLLAKC    351 - 420
RYTLQYTYPYAYYMESGPRKKLFEYQQAQLEAEIENLSWKVERADSYDRGDLENQMHIAEQRRRTLLKDF    421 - 490
HDT                                                                       491 - 493
//

Text Mined References (26)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24486325 2014 A novel feed-forward loop between ARIH2 E3-ligase and PABPN1 regulates aging-associated muscle degeneration.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
24076655 2013 TRIAD1 and HHARI bind to and are activated by distinct neddylated Cullin-RING ligase complexes.
24058416 2013 Structure of the HHARI catalytic domain shows glimpses of a HECT E3 ligase.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22940738 2012 TRIAD1 is negatively regulated by the MDM2 E3 ligase.
22819825 2012 TRIAD1 inhibits MDM2-mediated p53 ubiquitination and degradation.
22037423 2012 Differential regulation of PML-RAR? stability by the ubiquitin ligases SIAH1/SIAH2 and TRIAD1.
21454682 2011 HoxA10 influences protein ubiquitination by activating transcription of ARIH2, the gene encoding Triad1.
21269460 2011 Initial characterization of the human central proteome.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
19340006 2009 The ubiquitin ligase Triad1 inhibits myelopoiesis through UbcH7 and Ubc13 interacting domains.
17646546 2007 Gfi1 ubiquitination and proteasomal degradation is inhibited by the ubiquitin ligase Triad1.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16118314 2005 The E3 ubiquitin-protein ligase Triad1 inhibits clonogenic growth of primary myeloid progenitor cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10880484 2000 Ariadne-1: a vital Drosophila gene is required in development and defines a new conserved family of ring-finger proteins.
10422847 1999 TRIADs: a new class of proteins with a novel cysteine-rich signature.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.