Property Summary

NCBI Gene PubMed Count 57
PubMed Score 46.38
PubTator Score 48.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma -1.500 3.4e-07
posterior fossa group B ependymoma -1.600 3.8e-04
cystic fibrosis -1.581 5.8e-06
medulloblastoma, large-cell -2.600 3.4e-05
juvenile dermatomyositis 1.135 1.4e-08
acute quadriplegic myopathy 1.519 1.5e-04
primary pancreatic ductal adenocarcinoma 1.370 1.7e-03
intraductal papillary-mucinous adenoma (... -1.500 2.1e-02
intraductal papillary-mucinous carcinoma... -1.200 4.2e-02
lung cancer -1.100 8.7e-04
breast carcinoma -1.400 8.3e-05
Breast cancer 2.400 2.6e-02
sonic hedgehog group medulloblastoma -1.600 4.6e-04
invasive ductal carcinoma -1.149 2.4e-03
ulcerative colitis 1.100 1.3e-02
ovarian cancer 2.100 1.2e-03
pituitary cancer -1.700 1.4e-07
pancreatic cancer 1.600 6.5e-04
dermatomyositis 1.300 2.3e-02

 GO Component (2)

Gene RIF (33)

PMID Text
26104880 Non-coding variant rs10821936 in ARID5B was strongly associated with childhood B-cell acute lymphoblastic leukemia. No coding variants were associated with B-ALL susceptibility.
25806972 Interactions between rs10740055 in ARID5B or rs4132601 in IKZF1 and each of the suspected non-genetic factors were tested.
25761407 variants within IKZF1, ARID5B, and CEBPE were associated with increased acute lymphoblastic leukemia (ALL) risk, and the effects for ARID5B and CEBPE were most prominent in high-hyperdiploid ALL subtype in the California Hispanic population
25310577 These results evidence that interaction of genetic variants in ARID5B and IKZF1 and environmental exposures may further alter risk of childhood acute lymphoblastic leukemia.
25005032 Data indicate no significant associations of transcription factors rs4132601 (IKZF1), rs7089424 (ARID5B) and rs2239633 (CEBPE) with risk of pediatric non-Hodgkin lymphoma (NHL).
24712521 Our findings confirm the association of novel genetic variations in folate-related and ARID5B genes with the serum MTX levels and acute toxicity.
24564228 ARID5B polymorphism confers an increased risk to acquire specific MLL rearrangements in early childhood leukemia.
24561991 In an epigenome-wide methylation Norwegian Mother-Baby cohort study 2 ARID5B CpGs were identified in cord blood DNA as having an inverse association with birth weight (higher methylation fraction associated with lower birth weight).
24497567 Germline variants in IKZF1, ARID5B, and CEBPE as risk factors for adult-onset acute lymphoblastic leukemia: an analysis from the GMALL study group.
24200646 We found that rs7073837 in ARID5B correlated with a risk for childhood B lineage ALL.
24013273 The intron 3 of ARID5B gene was found to be strongly associated with B-ALL risk in the Spanish population examined.
23975371 ARID5B genetic polymorphism was associated with the increased risk of ALL.
23836053 study found that previously identified childhood acute lymphoblastic leukemia susceptibility loci in ARID5B and CEBPE show consistent risk effects across both Hispanic and non-Hispanic White populations, providing compelling supportive evidence for susceptibility at these loci
23692655 Data indicate associations between childhood acute lymphoblastic leukemia (ALL) and ARID5B and IKZF1 SNPs.
23608171 ARID5B single nucleotide polymorphism rs10821936 is associated with an increased risk of childhood acute lymphoblastic leukemia in Chinese population.
23118423 Association of the autoimmune thyroid disease phenotype (both Graves disease and Hashimoto's thyroiditis) with SNP rs6479778 located within the ARID5B gene.
23016962 Although germ-line SNPs in ARID5B, CEBPE, IKZF1 and CDKN2A are associated with the incidence of ALL in children, authors found no significant association between adult ALL cases and controls.
22971728 variants of rs2893880, rs10740055, rs7087507 and rs10761600 on the ARID5B gene were associated with susceptibility to type 2 diabetes
22922568 ARID5B polymorphisms are associated with childhood acute myeloblastic leukemia.
22660188 Single Nucleotide Polymorphism in ARID5B gene is associated with childhood acute lymphoblastic leukemia.
22291082 ARID5B polymorphisms are important determinants of childhood ALL susceptibility and treatment outcome, and they contribute to racial disparities in this disease.
21889209 Single nucleotide polymorphism in ARID5B gene is associated with childhood acute lymphoblastic leukemia.
20460642 confirmed the association of 5 SNPs [rs7073837 (P=4.2 x 10(-4)), rs10994982 (P=3.8 x 10(-4)), rs10740055 (P=1.6 x 10(-5)), rs10821936 (P=1.7 x 10(-7)) and rs7089424 (P=3.6 x 10(-7))] in the ARID5B gene with childhood acute lymphoblastic leukemia
20460642 Observational study of gene-disease association. (HuGE Navigator)
20054350 ARID5B SNP rs10821936 is associated with risk of childhood acute lymphoblastic leukemia in blacks and contributes to racial differences in leukemia incidence.
20054350 Observational study of gene-disease association. (HuGE Navigator)
20042726 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19684604 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19684603 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19684603 The ARID5B single nucleotide polymorphisms distinguished B-hyperdiploid ALL from other subtypes in an independent validation cohort and were associated with methotrexate accumulation and gene expression patterns in leukemic lymphoblasts.
18612189 The results implicate possible disease relevance of the polymorphisms in the Mrf-2 gene with susceptibility to CAD
18612189 Observational study of gene-disease association. (HuGE Navigator)
11478881 NMR spectroscopy studies of Mrf-2 in complex with DNA suggest that two flexible interhelical loops, the flexible C-terminal tail, and one alpha-helix are involved in DNA recognition, indicating the importance of protein dynamics in DNA binding.

AA Sequence

MEPNSLQWVGSPCGLHGPYIFYKAFQFHLEGKPRILSLGDFFFVRCTPKDPICIAELQLLWEERTSRQLL      1 - 70
SSSKLYFLPEDTPQGRNSDHGEDEVIAVSEKVIVKLEDLVKWVHSDFSKWRCGFHAGPVKTEALGRNGQK     71 - 140
EALLKYRQSTLNSGLNFKDVLKEKADLGEDEEETNVIVLSYPQYCRYRSMLKRIQDKPSSILTDQFALAL    141 - 210
GGIAVVSRNPQILYCRDTFDHPTLIENESICDEFAPNLKGRPRKKKPCPQRRDSFSGVKDSNNNSDGKAV    211 - 280
AKVKCEARSALTKPKNNHNCKKVSNEEKPKVAIGEECRADEQAFLVALYKYMKERKTPIERIPYLGFKQI    281 - 350
NLWTMFQAAQKLGGYETITARRQWKHIYDELGGNPGSTSAATCTRRHYERLILPYERFIKGEEDKPLPPI    351 - 420
KPRKQENSSQENENKTKVSGTKRIKHEIPKSKKEKENAPKPQDAAEVSSEQEKEQETLISQKSIPEPLPA    421 - 490
ADMKKKIEGYQEFSAKPLASRVDPEKDNETDQGSNSEKVAEEAGEKGPTPPLPSAPLAPEKDSALVPGAS    491 - 560
KQPLTSPSALVDSKQESKLCCFTESPESEPQEASFPSFPTTQPPLANQNETEDDKLPAMADYIANCTVKV    561 - 630
DQLGSDDIHNALKQTPKVLVVQSFDMFKDKDLTGPMNENHGLNYTPLLYSRGNPGIMSPLAKKKLLSQVS    631 - 700
GASLSSSYPYGSPPPLISKKKLIARDDLCSSLSQTHHGQSTDHMAVSRPSVIQHVQSFRSKPSEERKTIN    701 - 770
DIFKHEKLSRSDPHRCSFSKHHLNPLADSYVLKQEIQEGKDKLLEKRALPHSHMPSFLADFYSSPHLHSL    771 - 840
YRHTEHHLHNEQTSKYPSRDMYRESENSSFPSHRHQEKLHVNYLTSLHLQDKKSAAAEAPTDDQPTDLSL    841 - 910
PKNPHKPTGKVLGLAHSTTGPQESKGISQFQVLGSQSRDCHPKACRVSPMTMSGPKKYPESLSRSGKPHH    911 - 980
VRLENFRKMEGMVHPILHRKMSPQNIGAARPIKRSLEDLDLVIAGKKARAVSPLDPSKEVSGKEKASEQE    981 - 1050
SEGSKAAHGGHSGGGSEGHKLPLSSPIFPGLYSGSLCNSGLNSRLPAGYSHSLQYLKNQTVLSPLMQPLA   1051 - 1120
FHSLVMQRGIFTSPTNSQQLYRHLAAATPVGSSYGDLLHNSIYPLAAINPQAAFPSSQLSSVHPSTKL     1121 - 1188
//

Text Mined References (65)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26104880 2015 Inherited coding variants at the CDKN2A locus influence susceptibility to acute lymphoblastic leukaemia in children.
25806972 2015 ARID5B, IKZF1 and non-genetic factors in the etiology of childhood acute lymphoblastic leukemia: the ESCALE study.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25761407 2015 Association of genetic variation in IKZF1, ARID5B, and CEBPE and surrogates for early-life infections with the risk of acute lymphoblastic leukemia in Hispanic children.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25310577 2014 Confirmation of childhood acute lymphoblastic leukemia variants, ARID5B and IKZF1, and interaction with parental environmental exposures.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25005032 2015 Childhood acute lymphoblastic leukemia-associated risk-loci IKZF1, ARID5B and CEBPE and risk of pediatric non-Hodgkin lymphoma: a report from the Berlin-Frankfurt-Münster Study Group.
24751813 2014 Genome-wide association study supports the role of the immunological system and of the neurodevelopmental processes in response to haloperidol treatment.
24712521 2014 Associations of novel genetic variations in the folate-related and ARID5B genes with the pharmacokinetics and toxicity of high-dose methotrexate in paediatric acute lymphoblastic leukaemia.
24564228 2014 ARID5B polymorphism confers an increased risk to acquire specific MLL rearrangements in early childhood leukemia.
24561991 2014 Neonatal genome-wide methylation patterns in relation to birth weight in the Norwegian Mother and Child Cohort.
24497567 2014 Germline variants in IKZF1, ARID5B, and CEBPE as risk factors for adult-onset acute lymphoblastic leukemia: an analysis from the GMALL study group.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24200646 High-resolution melting analyses for genetic variants in ARID5B and IKZF1 with childhood acute lymphoblastic leukemia susceptibility loci in Taiwan.
24013273 2013 Intron 3 of the ARID5B gene: a hot spot for acute lymphoblastic leukemia susceptibility.
23996088 2013 Variation at 10p12.2 and 10p14 influences risk of childhood B-cell acute lymphoblastic leukemia and phenotype.
23975371 2014 ARID5B gene rs10821936 polymorphism is associated with childhood acute lymphoblastic leukemia: a meta-analysis based on 39,116 subjects.
23836053 2013 Genetic variants in ARID5B and CEBPE are childhood ALL susceptibility loci in Hispanics.
23752268 2013 The functional interactome landscape of the human histone deacetylase family.
23692655 2013 ARID5B and IKZF1 variants, selected demographic factors, and childhood acute lymphoblastic leukemia: a report from the Children's Oncology Group.
23608171 2013 Association of three polymorphisms in ARID5B, IKZF1 and CEBPE with the risk of childhood acute lymphoblastic leukemia in a Chinese population.
23512250 2013 Novel susceptibility variants at 10p12.31-12.2 for childhood acute lymphoblastic leukemia in ethnically diverse populations.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23291589 2013 Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus.
23273568 2013 Meta-analysis followed by replication identifies loci in or near CDKN1B, TET3, CD80, DRAM1, and ARID5B as associated with systemic lupus erythematosus in Asians.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23118423 2013 Fine mapping of loci linked to autoimmune thyroid disease identifies novel susceptibility genes.
23022100 2012 Discovery and fine mapping of serum protein loci through transethnic meta-analysis.
23016962 2012 Genetic polymorphisms in ARID5B, CEBPE, IKZF1 and CDKN2A in relation with risk of acute lymphoblastic leukaemia in adults: a Group for Research on Adult Acute Lymphoblastic Leukaemia (GRAALL) study.
22971728 2012 Associations of variations in the MRF2/ARID5B gene with susceptibility to type 2 diabetes in the Japanese population.
22922568 2013 Are ARID5B and IKZF1 polymorphisms also associated with childhood acute myeloblastic leukemia: the ESCALE study (SFCE)?
22660188 2012 Genetic polymorphisms and childhood acute lymphoblastic leukemia: GWAS of the ESCALE study (SFCE).
22446963 2012 Meta-analysis identifies nine new loci associated with rheumatoid arthritis in the Japanese population.
22291082 2012 ARID5B genetic polymorphisms contribute to racial disparities in the incidence and treatment outcome of childhood acute lymphoblastic leukemia.
22076464 2012 Identification of germline susceptibility loci in ETV6-RUNX1-rearranged childhood acute lymphoblastic leukemia.
21890642 2011 Regulated histone methyltransferase and demethylase complexes in the control of genes by nuclear receptors.
21889209 2011 Role of 657del5 NBN mutation and 7p12.2 (IKZF1), 9p21 (CDKN2A), 10q21.2 (ARID5B) and 14q11.2 (CEBPE) variation and risk of childhood ALL in the Polish population.
21532585 2011 PKA-dependent regulation of the histone lysine demethylase complex PHF2-ARID5B.
21098271 2010 Genetic landscape of high hyperdiploid childhood acute lymphoblastic leukemia.
20460642 2010 Replication analysis confirms the association of ARID5B with childhood B-cell acute lymphoblastic leukemia.
20189245 2010 Genome-wide association study of childhood acute lymphoblastic leukemia in Korea.
20054350 2010 ARID5B SNP rs10821936 is associated with risk of childhood acute lymphoblastic leukemia in blacks and contributes to racial differences in leukemia incidence.
20042726 2010 Verification of the susceptibility loci on 7p12.2, 10q21.2, and 14q11.2 in precursor B-cell acute lymphoblastic leukemia of childhood.
19684604 2009 Loci on 7p12.2, 10q21.2 and 14q11.2 are associated with risk of childhood acute lymphoblastic leukemia.
19684603 2009 Germline genomic variants associated with childhood acute lymphoblastic leukemia.
19430483 2009 Genome-wide association study identifies eight loci associated with blood pressure.
18612189 2008 Genetic variations of Mrf-2/ARID5B confer risk of coronary atherosclerosis in the Japanese population.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17407261 2007 Determination of the three-dimensional structure of the Mrf2-DNA complex using paramagnetic spin labeling.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15640446 2005 DNA-binding properties of ARID family proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11959810 2002 ARID proteins: a diverse family of DNA binding proteins implicated in the control of cell growth, differentiation, and development.
11483573 2001 Gene targeting of Desrt, a novel ARID class DNA-binding protein, causes growth retardation and abnormal development of reproductive organs.
11478881 2001 Dynamics of the Mrf-2 DNA-binding domain free and in complex with DNA.
10329386 1999 The novel Mrf-2 DNA-binding domain recognizes a five-base core sequence through major and minor-groove contacts.
9808040 1998 A novel DNA-binding motif shares structural homology to DNA replication and repair nucleases and polymerases.
8649988 1996 Repression by a differentiation-specific factor of the human cytomegalovirus enhancer.