Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.22
PubTator Score 6.02

Knowledge Summary


No data available


  Disease (3)

Disease Target Count P-value
Breast cancer 3469 6.6e-28
lung carcinoma 2755 5.4e-08
medulloblastoma, large-cell 6086 1.1e-05
tuberculosis 1963 1.3e-05
osteosarcoma 7766 8.1e-05
group 4 medulloblastoma 1806 1.7e-04
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.5
Disease Target Count Z-score Confidence
substance-related disorder 156 0.0 1.1


  Differential Expression (6)

Disease log2 FC p
Breast cancer -1.900 6.6e-28
group 4 medulloblastoma -1.300 1.7e-04
lung carcinoma -1.200 5.4e-08
medulloblastoma, large-cell -1.500 1.1e-05
osteosarcoma -1.116 8.1e-05
tuberculosis -1.500 1.3e-05

Gene RIF (2)

AA Sequence

SALRHRLCPASSAWHAPPVTTYAAPHFFHLNTKL                                        561 - 594

Text Mined References (14)

PMID Year Title