Property Summary

NCBI Gene PubMed Count 16
PubMed Score 12.76
PubTator Score 34.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
acute myeloid leukemia 1.200 2.5e-02
atypical teratoid / rhabdoid tumor 1.100 2.8e-04
diabetes mellitus 1.200 5.3e-03
malignant mesothelioma 1.700 2.0e-06
medulloblastoma, large-cell 1.500 1.7e-05
osteosarcoma -1.757 8.8e-06

Gene RIF (11)

AA Sequence

MEPLQQQQQQQQQQQKQPHLAPLQMDAREKQGQQMREAQFLYAQKLVTQPTLLSATAGRPSGSTPLGPLA      1 - 70
RVPPTAAVAQVFERGNMNSEPEEEDGGLEDEDGDDEVAEVAEKETQAASKYFHVQKVARQDPRVAPMSNL     71 - 140
LPAPGLPPHGQQAKEDHTKDASKASPSVSTAGQPNWNLDEQLKQNGGLAWSDDADGGRGREISRDFAKLY    141 - 210
ELDGDPERKEFLDDLFVFMQKRGTPINRIPIMAKQILDLYMLYKLVTEKGGLVEIINKKIWREITKGLNL    211 - 280
PTSITSAAFTLRTQYMKYLYAYECEKKALSSPAELQAAIDGNRREGRRPSYSSSLFGYSPAAATAAAAAG    281 - 350
APALLSPPKIRFPILGLGSSSGTNTSSPRISPATTLRKGDGAPVTTVPVPNRLAVPVTLASQQAGTRTAA    351 - 420
LEQLRERLESGEPAEKKASRLSEEEQRLVQQAFQRNFFSMARQLPMKIRINGRAEDRAEASAAALNLTTS    421 - 490
SIGSINMSVDIDGTTYAGVLFAQKPVVHLITGSAPQSLGSSASSSSSSHCSPSPTSSRGTPSAEPSTSWS    491 - 560
L//

Text Mined References (26)

PMID Year Title