Property Summary

NCBI Gene PubMed Count 14
PubMed Score 12.76
PubTator Score 34.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.700 2.0e-06
osteosarcoma -1.757 8.8e-06
atypical teratoid / rhabdoid tumor 1.100 2.8e-04
medulloblastoma, large-cell 1.500 1.7e-05
diabetes mellitus 1.200 5.3e-03
acute myeloid leukemia 1.300 1.8e-02

Gene RIF (9)

PMID Text
26519881 Although ARID3B and ARID3A share overlapping functions, ARID3B play a key role in the expression of pro-apoptotic p53-target genes and apoptosis.
25327563 ARID3B boosts production CD133+ tumor stem cells and increases ovarian cancer progression in vivo.
25120063 Data report a positive correlation between ER positivity and nuclear ARID3B expression in primary breast cancers, along with a negative correlation with the ERBB2 status.
24704276 The different patterns of ARID3B in normal tissues translate into different roles for ARID3B in carcinomas.
22860069 ARID3B Fl induces death receptor mediated apoptosis while the novel splice form ARID3B Sh does not induce cell death
22751132 Epigenetic regulation of the neuroblastoma genes, Arid3b and Mycn.
22307404 Among possible numerous targets of miR-125b, we showed ARID3B (AT-rich interactive domain 3B) to be a novel target with roles in cell motility in breast cancer cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19881956 We identify AT-rich interactive domain 3B (ARID3B) as a target of miR-125a and demonstrate that ARID3B is overexpressed in human ovarian cancer

AA Sequence

MEPLQQQQQQQQQQQKQPHLAPLQMDAREKQGQQMREAQFLYAQKLVTQPTLLSATAGRPSGSTPLGPLA      1 - 70
RVPPTAAVAQVFERGNMNSEPEEEDGGLEDEDGDDEVAEVAEKETQAASKYFHVQKVARQDPRVAPMSNL     71 - 140
LPAPGLPPHGQQAKEDHTKDASKASPSVSTAGQPNWNLDEQLKQNGGLAWSDDADGGRGREISRDFAKLY    141 - 210
ELDGDPERKEFLDDLFVFMQKRGTPINRIPIMAKQILDLYMLYKLVTEKGGLVEIINKKIWREITKGLNL    211 - 280
PTSITSAAFTLRTQYMKYLYAYECEKKALSSPAELQAAIDGNRREGRRPSYSSSLFGYSPAAATAAAAAG    281 - 350
APALLSPPKIRFPILGLGSSSGTNTSSPRISPATTLRKGDGAPVTTVPVPNRLAVPVTLASQQAGTRTAA    351 - 420
LEQLRERLESGEPAEKKASRLSEEEQRLVQQAFQRNFFSMARQLPMKIRINGRAEDRAEASAAALNLTTS    421 - 490
SIGSINMSVDIDGTTYAGVLFAQKPVVHLITGSAPQSLGSSASSSSSSHCSPSPTSSRGTPSAEPSTSWS    491 - 560
L//

Text Mined References (24)

PMID Year Title
26519881 2015 Critical role of ARID3B in the expression of pro-apoptotic p53-target genes and apoptosis.
25327563 2014 ARID3B increases ovarian tumor burden and is associated with a cancer stem cell gene signature.
25120063 2014 ARID3B expression in primary breast cancers and breast cancer-derived cell lines.
24704276 2014 Differential expression of ARID3B in normal adult tissue and carcinomas.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22860069 2012 ARID3B induces tumor necrosis factor alpha mediated apoptosis while a novel ARID3B splice form does not induce cell death.
22751132 2013 Epigenetic regulation of the neuroblastoma genes, Arid3b and Mycn.
22307404 2012 miR-125b targets ARID3B in breast cancer cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19881956 2009 The epidermal growth factor receptor responsive miR-125a represses mesenchymal morphology in ovarian cancer cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19430483 2009 Genome-wide association study identifies eight loci associated with blood pressure.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17400556 2007 REKLES is an ARID3-restricted multifunctional domain.
16951138 2006 ARID3B induces malignant transformation of mouse embryonic fibroblasts and is strongly associated with malignant neuroblastoma.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10838570 2000 ARID proteins come in from the desert.
10446990 1999 Bdp, a new member of a family of DNA-binding proteins, associates with the retinoblastoma gene product.