Property Summary

NCBI Gene PubMed Count 25
PubMed Score 14.64
PubTator Score 223.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 2.100 5.0e-03
ependymoma 2.700 6.3e-03
oligodendroglioma 2.200 9.6e-04
osteosarcoma 1.755 3.8e-05
group 3 medulloblastoma 2.000 2.1e-03
atypical teratoid / rhabdoid tumor 1.600 3.1e-03
primitive neuroectodermal tumor 1.600 4.0e-04
adrenocortical carcinoma 1.309 1.6e-03
intraductal papillary-mucinous adenoma (... 1.100 1.8e-03
intraductal papillary-mucinous carcinoma... 1.200 8.6e-03
Pick disease 1.400 9.4e-06
ovarian cancer -1.300 7.4e-10

Gene RIF (11)

PMID Text
26716708 Arid2 role in genome-wide transcriptional regulation by SWI/SNF complexes.
26238514 This is the first report of mutations in ARID2 associated with developmental delay and intellectual disabilities .
25701229 loss of ARID2 protein expression may be associated with recurrence of hepatocellular carcinoma
25636086 The subsequent validation study on 68 LCBs identified recurrent mutations in TERT promoter, chromatin regulators (BAP1, PBRM1 and ARID2), a synapse organization gene (PCLO), IDH genes and KRAS.
24382590 Mutations in ARID2 gene is associated with microsatellite unstable colorectal cancer.
23047306 Recurrent inactivating mutations of ARID2 is associated with non-small cell lung carcinoma.
22140357 A PBAF-specific component BAF200 is required for HIV-1 Tat-mediated activation of HIV LTR
22095441 we summarize the current knowledge about the relevance of ARID2 in Hepatocellular carcinoma and the implication in future patient care
21822264 18.2% of individuals with HCV-associated HCC in the United States and Europe harbored ARID2 inactivation mutations, suggesting that ARID2 is a tumor suppressor gene that is relatively commonly mutated in this tumor subtype.
20599239 A PBAF-specific component BAF200 is required for HIV-1 Tat-mediated activation of HIV LTR
16782067 zipzap may serve as a transcription co-activator for the regulation of cardiac gene expression

AA Sequence

MANSTGKAPPDERRKGLAFLDELRQFHHSRGSPFKKIPAVGGKELDLHGLYTRVTTLGGFAKVSEKNQWG      1 - 70
EIVEEFNFPRSCSNAAFALKQYYLRYLEKYEKVHHFGEDDDEVPPGNPKPQLPIGAIPSSYNYQQHSVSD     71 - 140
YLRQSYGLSMDFNSPNDYNKLVLSLLSGLPNEVDFAINVCTLLSNESKHVMQLEKDPKIITLLLANAGVF    141 - 210
DDTLGSFSTVFGEEWKEKTDRDFVKFWKDIVDDNEVRDLISDRNKSHEGTSGEWIWESLFHPPRKLGIND    211 - 280
IEGQRVLQIAVILRNLSFEEGNVKLLAANRTCLRFLLLSAHSHFISLRQLGLDTLGNIAAELLLDPVDFK    281 - 350
TTHLMFHTVTKCLMSRDRFLKMRGMEILGNLCKAEDNGVLICEYVDQDSYREIICHLTLPDVLLVISTLE    351 - 420
VLYMLTEMGDVACTKIAKVEKSIDMLVCLVSMDIQMFGPDALAAVKLIEHPSSSHQMLSEIRPQAIEQVQ    421 - 490
TQTHVASAPASRAVVAQHVAPPPGIVEIDSEKFACQWLNAHFEVNPDCSVSRAEMYSEYLSTCSKLARGG    491 - 560
ILTSTGFYKCLRTVFPNHTVKRVEDSSSNGQAHIHVVGVKRRAIPLPIQMYYQQQPVSTSVVRVDSVPDV    561 - 630
SPAPSPAGIPHGSQTIGNHFQRTPVANQSSNLTATQMSFPVQGVHTVAQTVSRIPQNPSPHTHQQQNAPV    631 - 700
TVIQSKAPIPCEVVKATVIQNSIPQTGVPVSIAVGGGPPQSSVVQNHSTGPQPVTVVNSQTLLHHPSVIP    701 - 770
QQSPLHTVVPGQIPSGTPVTVIQQAVPQSHMFGRVQNIPACTSTVSQGQQLITTSPQPVQTSSQQTSAGS    771 - 840
QSQDTVIIAPPQYVTTSASNIVSATSVQNFQVATGQMVTIAGVPSPQASRVGFQNIAPKPLPSQQVSSTV    841 - 910
VQQPIQQPQQPTQQSVVIVSQPAQQGQTYAPAIHQIVLANPAALPAGQTVQLTGQPNITPSSSPSPVPAT    911 - 980
NNQVPTAMSSSSTPQSQGPPPTVSQMLSVKRQQQQQHSPAPPPQQVQVQVQQPQQVQMQVQPQQSNAGVG    981 - 1050
QPASGESSLIKQLLLPKRGPSTPGGKLILPAPQIPPPNNARAPSPQVVYQVASNQAAGFGVQGQTPAQQL   1051 - 1120
LVGQQNVQLVPSAMPPSGGVQTVPISNLQILPGPLISNSPATIFQGTSGNQVTITVVPNTSFAPATVSQG   1121 - 1190
NATQLIAPAGITMSGTQTGVGLPVQTLPATQASPAGQSSCTTATPPFKGDKIICQKEEEAKEATGLHVHE   1191 - 1260
RKIEVMENPSCRRGATNTSNGDTKENEMHVGSLLNGRKYSDSSLPPSNSGKIQSETNQCSLISNGPSLEL   1261 - 1330
GENGASGKQNSEQIDMQDIKSDLRKPLVNGICDFDKGDGSHLSKNIPNHKTSNHVGNGEISPMEPQGTLD   1331 - 1400
ITQQDTAKGDQLERISNGPVLTLGGSSVSSIQEASNAATQQFSGTDLLNGPLASSLNSDVPQQRPSVVVS   1401 - 1470
PHSTTSVIQGHQIIAVPDSGSKVSHSPALSSDVRSTNGTAECKTVKRPAEDTDRETVAGIPNKVGVRIVT   1471 - 1540
ISDPNNAGCSATMVAVPAGADPSTVAKVAIESAVQQKQQHPPTYVQNVVPQNTPMPPSPAVQVQGQPNSS   1541 - 1610
QPSPFSGSSQPGDPMRKPGQNFMCLWQSCKKWFQTPSQVFYHAATEHGGKDVYPGQCLWEGCEPFQRQRF   1611 - 1680
SFITHLQDKHCSKDALLAGLKQDEPGQAGSQKSSTKQPTVGGTSSTPRAQKAIVNHPSAALMALRRGSRN   1681 - 1750
LVFRDFTDEKEGPITKHIRLTAALILKNIGKYSECGRRLLKRHENNLSVLAISNMEASSTLAKCLYELNF   1751 - 1820
TVQSKEQEKDSEMLQ                                                          1821 - 1835
//

Text Mined References (31)

PMID Year Title
26716708 2015 Genome-Wide Transcriptional Regulation Mediated by Biochemically Distinct SWI/SNF Complexes.
26238514 2015 Mutations in ARID2 are associated with intellectual disabilities.
26169693 2015 miR-208-3p promotes hepatocellular carcinoma cell proliferation and invasion through regulating ARID2 expression.
25701229 2015 AT-rich interactive domain 2, p110?, p53, and ?-catenin protein expression in hepatocellular carcinoma and clinicopathologic implications.
25636086 2015 Whole-genome mutational landscape of liver cancers displaying biliary phenotype reveals hepatitis impact and molecular diversity.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24382590 2014 Exome sequencing reveals frequent inactivating mutations in ARID1A, ARID1B, ARID2 and ARID4A in microsatellite unstable colorectal cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23047306 2013 Recurrent inactivating mutations of ARID2 in non-small cell lung carcinoma.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22095441 2011 ARID2: a new tumor suppressor gene in hepatocellular carcinoma.
21822264 2011 Inactivating mutations of the chromatin remodeling gene ARID2 in hepatocellular carcinoma.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19668339 2009 Hippocampal atrophy as a quantitative trait in a genome-wide association study identifying novel susceptibility genes for Alzheimer's disease.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16782067 2006 Zipzap/p200 is a novel zinc finger protein contributing to cardiac gene regulation.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15985610 2005 PBAF chromatin-remodeling complex requires a novel specificity subunit, BAF200, to regulate expression of selective interferon-responsive genes.
15922553 2005 Nomenclature of the ARID family of DNA-binding proteins.
15640446 2005 DNA-binding properties of ARID family proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15159402 2004 Identification of interaction partners and substrates of the cyclin A1-CDK2 complex.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15060132 2004 Differential targeting of two distinct SWI/SNF-related Drosophila chromatin-remodeling complexes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12672490 2003 Recent advances in understanding chromatin remodeling by Swi/Snf complexes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10997877 2000 Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8895581 1996 Purification and biochemical heterogeneity of the mammalian SWI-SNF complex.