Property Summary

NCBI Gene PubMed Count 92
PubMed Score 139.08
PubTator Score 46.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytoma -2.200 3.7e-25
ependymoma -4.100 3.0e-26
oligodendroglioma -2.200 2.7e-18
psoriasis -1.600 4.8e-05
glioblastoma -3.900 9.4e-08
osteosarcoma -1.268 6.8e-04
atypical teratoid / rhabdoid tumor -3.900 8.1e-08
group 3 medulloblastoma -1.400 3.6e-02
medulloblastoma, large-cell -2.800 3.2e-07
primitive neuroectodermal tumor -1.600 4.2e-02
tuberculosis -1.400 8.5e-07
intraductal papillary-mucinous carcinoma... 1.100 9.7e-03
intraductal papillary-mucinous neoplasm ... 1.200 5.2e-03
pediatric high grade glioma -3.300 9.4e-09
pilocytic astrocytoma -3.900 4.1e-13
subependymal giant cell astrocytoma -2.984 4.5e-03
Pick disease -1.400 1.8e-02
progressive supranuclear palsy 1.100 4.0e-02
ovarian cancer 1.900 4.5e-07

Gene RIF (38)

PMID Text
27012601 Data show association of G protein-coupled receptor kinase-interacting protein 1 (GIT1), p21-activated kinase interacting exchange factor (betaPIX), and p21 protein (Cdc42/Rac)-activated kinase 1 (PAK1) with centrosomes.
25683605 Data show the role of Rho guanine nucleotide exchange factor 7 (beta-PIX) to the regulation of high mobility of lung adenocarcinoma cell line H1299 via regulation of focal adhesions dynamics, changes in actin cytoskeleton organization and cell polarity.
25500533 Phosphorylation of LRRK2 by casein kinase 1alpha regulates trans-Golgi clustering via differential interaction with ARHGEF7.
25425573 Conversely, increased expression of betaPIX in breast cancer cell lines re-couples the Hippo kinase cassette to Yap/Taz, promoting localization of Yap/Taz to the cytoplasm and inhibiting cell migration and proliferation.
25284783 GIT1/betaPIX/Rac1/PAK pathway plays a crucial role in regulating GABA(A)R synaptic stability and hence inhibitory synaptic transmission with important implications for inhibitory plasticity and information processing in the brain.
25150978 The interaction of betaPix with srGAP1 is critical for maintaining suppressive crosstalk between Cdc42 and RhoA during 3D collagen migration.
24792722 BetaPix phosphorylation at Ser-340 upregulates Nox1 through Rac activation.
24458840 Data indicate that suppression of c-Cbl protein by rho guanine nucleotide exchange factor 7 (Cool-1) may be critical for generation of at least a subset of glioblastoma (GBM).
24129564 beta1Pix functions as a transcriptional regulator of beta-catenin signaling through direct interaction with beta-catenin, an action that may be functionally relevant to colon cancer biology.
23740575 BETA-PIX is a novel downstream signalling mediator during invadopodia formation.
23615439 Data suggest a coordination between paxillin kinase linker (PKL)/Vav2 signaling and PKL/beta-PIX signaling during cell migration.
23288365 Inhibition of glycogen synthase kinase (GSK)-3beta increases the migration capacity of mesenchymal stromal cells during ex vivo expansion.
22945935 These defects could be rescued by depletion of ARHGEF7 and p21-activated kinase, Rac1-specific effector proteins required for cell adhesion.
22588125 It has identified and characterized a novel interaction between CaM and beta-p21-activated kinase interacting exchange factor (beta-PIX), a putative guanine exchange factor implicated in cell signaling.
22087847 In vivo migratory capacity of mesenchymal stromal cells depends upon the expression level of beta-PIX.
21926430 a model by which SNX27 regulates trafficking of beta-Pix to focal adhesions and thereby influences cell motility.
21423176 Results describe the role of beta-Pix in the negative regulation of focal adhesion maturation and the promotion of lamellipodial protrusion and focal adhesion turnover to drive cell migration.
21048939 Downstream effects of phosphorylation of ARHGEF7 through LRRK2 could be (i) a feedback control mechanism for LRRK2 activity as well as (ii) an impact of LRRK2 on actin cytoskeleton regulation
20395446 Data show that podocalyxin overexpression in human embryonic kidney cells up-regulates Rac1 activity, which depends on a complex formed by podocalyxin, ERM-binding phosphoprotein 50, ezrin, and ARHGEF7, a Rac1 activator.
20080968 betaPix up-regulates NHE3 membrane expression and activity by Shank2-mediated protein-protein interaction and by activating Rho GTPases in the apical regions of epithelial cells
19923322 MYO18A is a novel binding partner of the PAK2/betaPIX/GIT1 complex and suggest that MYO18A may play an important role in regulating epithelial cell migration via affecting multiple cell machineries.
19303398 betaPIX and GIT1 regulate the hepatocyte growth factor-induced and Rac1-dependent membrane transport of WAVE2 and consequently, lamellipodia formation.
18684957 Beta-PIX regulates nitric oxide synthase type 2 (NOD2) trafficking and NOD2-dependent signal transduction in primary human monocytes and cell line THP-1.
18445079 Data show that the Rac1 guanine exchange factor- beta-Pix, localizes to focal contacts in human primary Schwannoma cells.
18385518 These results identify p66Shc and FOXO3a as novel partners of beta(1)Pix and represent the first direct evidence of beta(1)Pix in cell proliferation via Erk/p66Shc-dependent and Akt-independent mechanisms.
18325335 mutant betaPIX lacking guanine nucleotide exchange factor activity inhibited lamellipodium formation
18160719 PKA-dependent phosphorylation modulates PIXB activity through 14-3-3-beta binding.
17562871 The association of PLCgamma1 with complexes containing GIT1 and beta-Pix is essential for its role in integrin-mediated cell spreading and motility. As a component of this complex, PLCgamma1 is also involved in the activation of Cdc42 and Rac1.
17219408 Tiam1 and betaPIX mediate OxPAPC-induced Rac activation, cytoskeletal remodeling, and barrier protective response in pulmonary endothelium
16983070 These data strongly suggest that, in addition to the known SAP-interacting kinase Fyn, PIX may be another key player in SAP-mediated T cell activation.
16492808 Rac1-beta-Pix interaction is required for Rac1 activation by beta-Pix as well as for Rac1-mediated spreading
16407834 the SH3 domain of betaPix specifically interacts with a proline-arginine motif (PxxxPR) present within the ubiquitin ligase Cbl and Pak1 kinase. Cdc42/betaPix complex blocks Cbl's ability to downregulate EGFR.
16356860 In the presence of Nef, lipid raft Cdc42 is activated and forms a ternary complex between the c-Cbl-interacting protein p85Cool-1/betaPix and c-Cbl, displacing UbcH7 from rafts
16329988 These results suggest that the formation of the complex consisting of Nox1, betaPix, and NoxO1 is likely to be a critical step in EGF-induced ROS generation.
15864311 PAK1 recruitment to the T cell-antigen-presenting cell interface required interaction with PIX.
15212761 PIX protein is tightly associated with the GIT family ARF GTPase-activating proteins as a multimeric nexus capable of linking together important signaling molecules.
14559906 the interaction of the betaPIX.WASP.SPIN90 complex with Nck is crucial for stable cell adhesion and can be dynamically modulated by SPIN90 phosphorylation that is dependent on cell adhesion and ERK activation
14557270 bFGF- and NGF-induced phosphorylation of p85 betaPIX mediates Rac1 activation, which in turn regulates cytoskeletal reorganization at growth cones, but not translocation of the PIX complex.

AA Sequence

MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKVYPEPRSESECLSNI      1 - 70
REFLRGCGASLRLELLFPPSQPPQHLVTTILLSASTFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSD     71 - 140
SVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMTDNSNNQLVVRAKFNFQQTNEDELSFSKGDV    141 - 210
IHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNIL    211 - 280
ETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCF    281 - 350
LNLMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKEL    351 - 420
ERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQC    421 - 490
AGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSC    491 - 560
NNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHG    561 - 630
TPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFAS    631 - 700
RKSTAALEEDAQILKVIEAYCTSAKTRQTLNSTWQGTDLMHNHVLADDDQPSLDSLGRRSSLSRLEPSDL    701 - 770
SEDSDYDSIWTAHSYRMGSTSRKSCCSYISHQN                                         771 - 803
//

Text Mined References (104)

PMID Year Title
27012601 2016 GIT1/?PIX signaling proteins and PAK1 kinase regulate microtubule nucleation.
25683605 2015 ?-PIX controls intracellular viscoelasticity to regulate lung cancer cell migration.
25500533 2014 Phosphorylation of LRRK2 by casein kinase 1? regulates trans-Golgi clustering via differential interaction with ARHGEF7.
25425573 2014 Arhgef7 promotes activation of the Hippo pathway core kinase Lats.
25416956 2014 A proteome-scale map of the human interactome network.
25284783 2014 GIT1 and ?PIX are essential for GABA(A) receptor synaptic stability and inhibitory neurotransmission.
25150978 2014 An extracellular-matrix-specific GEF-GAP interaction regulates Rho GTPase crosstalk for 3D collagen migration.
24792722 2014 Nox1 activation by ?Pix and the role of Ser-340 phosphorylation.
24458840 2014 Cool-1-mediated inhibition of c-Cbl modulates multiple critical properties of glioblastomas, including the ability to generate tumors in vivo.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24204828 2013 Genome-wide contribution of genotype by environment interaction to variation of diabetes-related traits.
24129564 2013 The Cdc42/Rac nucleotide exchange factor protein ?1Pix (Pak-interacting exchange factor) modulates ?-catenin transcriptional activity in colon cancer cells: evidence for direct interaction of ?1PIX with ?-catenin.
23740575 2013 Hypoxia-induced invadopodia formation: a role for ?-PIX.
23615439 2013 Paxillin kinase linker (PKL) regulates Vav2 signaling during cell spreading and migration.
23563176 2014 Tax-interacting protein 1 coordinates the spatiotemporal activation of Rho GTPases and regulates the infiltrative growth of human glioblastoma.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23288365 2013 Direct GSK-3? inhibition enhances mesenchymal stromal cell migration by increasing expression of ?-PIX and CXCR4.
23285027 2012 Bin2 is a membrane sculpting N-BAR protein that influences leucocyte podosomes, motility and phagocytosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22945935 2012 CYK4 inhibits Rac1-dependent PAK1 and ARHGEF7 effector pathways during cytokinesis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22588125 2012 A novel calmodulin-?-PIX interaction and its implication in receptor tyrosine kinase regulation.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22087847 2012 ?-PIX is critical for transplanted mesenchymal stromal cell migration.
21926430 2011 Sorting nexin 27 protein regulates trafficking of a p21-activated kinase (PAK) interacting exchange factor (?-Pix)-G protein-coupled receptor kinase interacting protein (GIT) complex via a PDZ domain interaction.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21295525 2011 N-?-acetyltransferase 10 protein suppresses cancer cell metastasis by binding PIX proteins and inhibiting Cdc42/Rac1 activity.
21269460 2011 Initial characterization of the human central proteome.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
21048939 2010 ARHGEF7 (Beta-PIX) acts as guanine nucleotide exchange factor for leucine-rich repeat kinase 2.
20936779 2010 A human MAP kinase interactome.
20395446 2010 Podocalyxin EBP50 ezrin molecular complex enhances the metastatic potential of renal cell carcinoma through recruiting Rac1 guanine nucleotide exchange factor ARHGEF7.
20080968 2010 BetaPix up-regulates Na+/H+ exchanger 3 through a Shank2-mediated protein-protein interaction.
19923322 2010 Identification of MYO18A as a novel interacting partner of the PAK2/betaPIX/GIT1 complex and its potential function in modulating epithelial cell migration.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19555689 2009 MCC, a new interacting protein for Scrib, is required for cell migration in epithelial cells.
19448619 2009 Loci at chromosomes 13, 19 and 20 influence age at natural menopause.
19414484 2009 Genome-wide association meta-analysis for total serum bilirubin levels.
19303398 2009 BetaPIX and GIT1 regulate HGF-induced lamellipodia formation and WAVE2 transport.
19118189 2008 Preso, a novel PSD-95-interacting FERM and PDZ domain protein that regulates dendritic spine morphogenesis.
19041750 2008 Deregulation of scribble promotes mammary tumorigenesis and reveals a role for cell polarity in carcinoma.
18716323 2008 Scrib regulates PAK activity during the cell migration process.
18684957 2008 Beta-PIX and Rac1 GTPase mediate trafficking and negative regulation of NOD2.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18445079 2009 Altered adhesive structures and their relation to RhoGTPase activation in merlin-deficient Schwannoma.
18385518 2008 Endothelin-1 couples betaPix to p66Shc: role of betaPix in cell proliferation through FOXO3a phosphorylation and p27kip1 down-regulation independently of Akt.
18325335 2008 Affixin activates Rac1 via betaPIX in C2C12 myoblast.
18184567 2008 Activity-dependent synaptogenesis: regulation by a CaM-kinase kinase/CaM-kinase I/betaPIX signaling complex.
18160719 2008 Protein kinase A-dependent phosphorylation modulates beta1Pix guanine nucleotide exchange factor activity through 14-3-3beta binding.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17562871 2007 Role of phospholipase Cgamma1 in cell spreading requires association with a beta-Pix/GIT1-containing complex, leading to activation of Cdc42 and Rac1.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17310244 2007 Grb4 and GIT1 transduce ephrinB reverse signals modulating spine morphogenesis and synapse formation.
17219408 2007 Tiam1 and betaPIX mediate Rac-dependent endothelial barrier protective response to oxidized phospholipids.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16983070 2006 The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation.
16892055 2006 Cool-1 functions as an essential regulatory node for EGF receptor- and Src-mediated cell growth.
16787945 2006 betaPIX controls cell motility and neurite extension by regulating the distribution of GIT1.
16628223 2006 GIT2 represses Crk- and Rac1-regulated cell spreading and Cdc42-mediated focal adhesion turnover.
16492808 2006 Targeting and activation of Rac1 are mediated by the exchange factor beta-Pix.
16407834 2006 Cbl escapes Cdc42-mediated inhibition by downregulation of the adaptor molecule betaPix.
16374509 2006 Identification of preferred protein interactions by phage-display of the human Src homology-3 proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16329988 2006 Molecular interaction of NADPH oxidase 1 with betaPix and Nox Organizer 1.
16101281 2005 Structural analysis of the SH3 domain of beta-PIX and its interaction with alpha-p21 activated kinase (PAK).
15975580 2005 hScrib interacts with ZO-2 at the cell-cell junctions of epithelial cells.
15864311 2005 Dynamic recruitment of PAK1 to the immunological synapse is mediated by PIX independently of SLP-76 and Vav1.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15649357 2005 The Cool-2/alpha-Pix protein mediates a Cdc42-Rac signaling cascade.
15491607 2004 Alternative splice variants encoding unstable protein domains exist in the human brain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15212761 2004 The GIT/PIX complex: an oligomeric assembly of GIT family ARF GTPase-activating proteins and PIX family Rac1/Cdc42 guanine nucleotide exchange factors.
15182672 2004 Mammalian Scribble forms a tight complex with the betaPIX exchange factor.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14559906 2003 Regulation of SPIN90 phosphorylation and interaction with Nck by ERK and cell adhesion.
14557270 2004 Basic fibroblast growth factor stimulates activation of Rac1 through a p85 betaPIX phosphorylation-dependent pathway.
14505571 2003 Activated Cdc42 sequesters c-Cbl and prevents EGF receptor degradation.
12935897 2003 The Cbl proteins are binding partners for the Cool/Pix family of p21-activated kinase-binding proteins.
12888525 2003 Computational identification of protein coding potential of conserved sequence tags through cross-species evolutionary analysis.
12880961 2003 Neuroblastoma oligo-capping cDNA project: toward the understanding of the genesis and biology of neuroblastoma.
12695502 2003 Synapse formation is regulated by the signaling adaptor GIT1.
12626503 2003 The Shank family of postsynaptic density proteins interacts with and promotes synaptic accumulation of the beta PIX guanine nucleotide exchange factor for Rac1 and Cdc42.
12499396 2003 Interaction of alphaPIX (ARHGEF6) with beta-parvin (PARVB) suggests an involvement of alphaPIX in integrin-mediated signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226077 2002 Phosphorylation of p85 beta PIX, a Rac/Cdc42-specific guanine nucleotide exchange factor, via the Ras/ERK/PAK2 pathway is required for basic fibroblast growth factor-induced neurite outgrowth.
12006652 2002 Paxillin-dependent paxillin kinase linker and p21-activated kinase localization to focal adhesions involves a multistep activation pathway.
11864573 2002 The p21-activated kinase PAK is negatively regulated by POPX1 and POPX2, a pair of serine/threonine phosphatases of the PP2C family.
11157752 2001 A PAK1-PIX-PKL complex is activated by the T-cell receptor independent of Nck, Slp-76 and LAT.
10896954 2000 The GIT family of ADP-ribosylation factor GTPase-activating proteins. Functional diversity of GIT2 through alternative splicing.
10428811 1999 A tyrosine-phosphorylated protein that binds to an important regulatory region on the cool family of p21-activated kinase-binding proteins.
10330411 1999 Paxillin LD4 motif binds PAK and PIX through a novel 95-kD ankyrin repeat, ARF-GAP protein: A role in cytoskeletal remodeling.
9846881 1998 Structure and mutagenesis of the Dbl homology domain.
9726964 1998 A novel regulator of p21-activated kinases.
9659915 1998 PAK kinases are directly coupled to the PIX family of nucleotide exchange factors.
9207241 1997 Cloning of a SH3 domain-containing proline-rich protein, p85SPR, and its localization in focal adhesion.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8590280 1995 Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1.
8076819 1994 The addition of 5'-coding information to a 3'-directed cDNA library improves analysis of gene expression.