Property Summary

NCBI Gene PubMed Count 96
PubMed Score 152.76
PubTator Score 46.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -2.400 8.8e-07
astrocytic glioma 1.500 1.1e-02
Astrocytoma, Pilocytic -3.100 1.1e-13
atypical teratoid / rhabdoid tumor -2.900 8.1e-10
ependymoma 1.300 7.0e-03
glioblastoma -2.400 2.2e-09
group 3 medulloblastoma -1.200 1.1e-02
intraductal papillary-mucinous carcinoma... 1.100 9.7e-03
intraductal papillary-mucinous neoplasm ... 1.100 1.4e-02
medulloblastoma, large-cell -2.400 8.8e-06
oligodendroglioma 1.600 3.9e-03
osteosarcoma -1.268 6.8e-04
ovarian cancer -1.600 8.2e-09
Pick disease -1.400 1.8e-02
primitive neuroectodermal tumor -1.600 4.2e-02
progressive supranuclear palsy 1.100 4.0e-02
psoriasis -1.600 4.8e-05
subependymal giant cell astrocytoma -2.702 2.5e-03
tuberculosis -1.400 8.5e-07

Gene RIF (40)

AA Sequence

MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKVYPEPRSESECLSNI      1 - 70
REFLRGCGASLRLELLFPPSQPPQHLVTTILLSASTFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSD     71 - 140
SVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMTDNSNNQLVVRAKFNFQQTNEDELSFSKGDV    141 - 210
IHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNIL    211 - 280
ETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCF    281 - 350
LNLMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKEL    351 - 420
ERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQC    421 - 490
AGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSC    491 - 560
NNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHG    561 - 630
TPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFAS    631 - 700
RKSTAALEEDAQILKVIEAYCTSAKTRQTLNSTWQGTDLMHNHVLADDDQPSLDSLGRRSSLSRLEPSDL    701 - 770
SEDSDYDSIWTAHSYRMGSTSRKSCCSYISHQN                                         771 - 803
//

Text Mined References (108)

PMID Year Title