Property Summary

NCBI Gene PubMed Count 31
PubMed Score 16.66
PubTator Score 16.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -5.500 1.5e-09
astrocytic glioma -1.100 7.1e-03
posterior fossa group B ependymoma -1.800 2.0e-05
oligodendroglioma -1.200 4.1e-02
osteosarcoma -2.122 3.7e-05
cystic fibrosis 1.482 2.3e-04
atypical teratoid / rhabdoid tumor -1.800 8.0e-04
glioblastoma -1.100 1.3e-02
medulloblastoma -1.300 1.2e-03
medulloblastoma, large-cell -2.600 8.2e-06
primitive neuroectodermal tumor -1.400 2.5e-02
non-small cell lung cancer -1.230 1.9e-17
lung cancer -1.200 6.4e-03
active Crohn's disease 2.210 5.4e-03
active ulcerative colitis 2.484 4.6e-03
ovarian cancer -1.600 1.5e-05
pituitary cancer 1.500 4.6e-06

Protein-protein Interaction (5)

Gene RIF (12)

PMID Text
25494542 ARHGEF3 has a crucial role in myeloid differentiation.
24840563 ARHGEF3 and RHOA are potential regulators of a number of genes in bone cells, with influences on ACTA2 evident in both osteoblast-like and osteoclast-like cells.
24043828 XPLN is an endogenous inhibitor of mTORC2.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19911011 Observational study of gene-disease association. (HuGE Navigator)
19727905 the association between rs7646054 in ARHGEF3 and bone mineral density observed in Caucasians was not replicated in the chinese samples.
19727905 Observational study of gene-disease association. (HuGE Navigator)
19427924 Observational study of gene-disease association. (HuGE Navigator)
19110211 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18499081 genetic variation in ARHGEF3 plays a role in the determination of bone density in Caucasian women. This data implicates the RhoGTPase-RhoGEF pathway in osteoporosis.
18499081 Observational study of gene-disease association. (HuGE Navigator)
12221096 a guanine nucleotide exchange factor for RhoA and RhoB, but not RhoC

AA Sequence

MVAKDYPFYLTVKRANCSLELPPASGPAKDAEEPSNKRVKPLSRVTSLANLIPPVKATPLKRFSQTLQRS      1 - 70
ISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKEIKRQEAIFELSQGEEDLIED     71 - 140
LKLAKKAYHDPMLKLSIMTEQELNQIFGTLDSLIPLHEELLSQLRDVRKPDGSTEHVGPILVGWLPCLSS    141 - 210
YDSYCSNQVAAKALLDHKKQDHRVQDFLQRCLESPFSRKLDLWNFLDIPRSRLVKYPLLLREILRHTPND    211 - 280
NPDQQHLEEAINIIQGIVAEINTKTGESECRYYKERLLYLEEGQKDSLIDSSRVLCCHGELKNNRGVKLH    281 - 350
VFLFQEVLVITRAVTHNEQLCYQLYRQPIPVKDLLLEDLQDGEVRLGGSLRGAFSNNERIKNFFRVSFKN    351 - 420
GSQSQTHSLQANDTFNKQQWLNCIRQAKETVLCAAGQAGVLDSEGSFLNPTTGSRELQGETKLEQMDQSD    421 - 490
SESDCSMDTSEVSLDCERMEQTDSSCGNSRHGESNV                                      491 - 526
//

Text Mined References (32)

PMID Year Title
25494542 2015 ARHGEF3 controls HDACi-induced differentiation via RhoA-dependent pathways in acute myeloid leukemias.
25416956 2014 A proteome-scale map of the human interactome network.
24840563 2014 Influence of ARHGEF3 and RHOA knockdown on ACTA2 and other genes in osteoblasts and osteoclasts.
24043828 2013 XPLN is an endogenous inhibitor of mTORC2.
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
23263863 2013 GWAS of blood cell traits identifies novel associated loci and epistatic interactions in Caucasian and African-American children.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21452313 2011 Genome-wide association study of rheumatoid arthritis in Koreans: population-specific loci as well as overlap with European susceptibility loci.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19911011 2010 Mutation of ARHGAP9 in patients with coronary spastic angina.
19820697 2009 A genome-wide meta-analysis identifies 22 loci associated with eight hematological parameters in the HaemGen consortium.
19727905 2010 Common variants in FLNB/CRTAP, not ARHGEF3 at 3p, are associated with osteoporosis in southern Chinese women.
19427924 2009 Further genetic evidence suggesting a role for the RhoGTPase-RhoGEF pathway in osteoporosis.
19110211 2009 A genome-wide association study identifies three loci associated with mean platelet volume.
18499081 2008 Identification of a role for the ARHGEF3 gene in postmenopausal osteoporosis.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12376548 2002 NRAGE, a p75 neurotrophin receptor-interacting protein, induces caspase activation and cell death through a JNK-dependent mitochondrial pathway.
12221096 2002 XPLN, a guanine nucleotide exchange factor for RhoA and RhoB, but not RhoC.
11756498 2002 Activation of Rac GTPase by p75 is necessary for c-jun N-terminal kinase-mediated apoptosis.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10873612 2000 Isolation of two novel human RhoGEFs, ARHGEF3 and ARHGEF4, in 3p13-21 and 2q22.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.