Property Summary

NCBI Gene PubMed Count 17
PubMed Score 27.33
PubTator Score 13.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
cutaneous lupus erythematosus -1.400 2.3e-02
psoriasis -1.600 6.3e-03
medulloblastoma, large-cell 1.100 1.1e-03
adrenocortical carcinoma -1.239 6.0e-03
interstitial cystitis -1.500 6.4e-05
lung carcinoma 2.000 1.1e-27
spina bifida -2.141 2.8e-02
Breast cancer -2.000 7.1e-22
ductal carcinoma in situ -1.500 4.2e-04
invasive ductal carcinoma -1.600 8.4e-04
pituitary cancer -2.300 2.5e-07

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (9)

PMID Text
25922072 results show that Rgnef functions as an effector of Galpha13 signaling and that this linkage may mediate FAK activation in DLD-1 colon carcinoma cells
24712971 This study showed that ARHGEF28 gene exon 6/intron 6 junction mutations in Chinese amyotrophic lateral sclerosis cohort.
23286752 Study identified a heterozygous mutation in amyotrophic lateral sclerosis patients that is predicted to generate a premature truncated ARHGEF28 gene product. There were extensive regions of homozygosity in the ARHGEF28 gene in two familial ALS patients.
22941224 This study demonistrated that RGNEF-immunoreactive neuronal cytoplasmic inclusions (NCIs) can co-localize with TDP-43, FUS/TLS and p62 within spinal motor neurons.
21224360 Studies identify Rgnef as a novel regulator of colon carcinoma motility and invasion, and they show that a Rgnef-FAK linkage promotes colon carcinoma progression in vivo.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20200978 Observational study of gene-disease association. (HuGE Navigator)
19488899 RGNEF is a human homologue of p190RhoGEF, and its RNA is expressed in both brain and spinal cord
19460752 Knockdown of 190 kDa guanine nucleotide exchange factor (RGNEF) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MELSCSEAPLYGQMMIYAKFDKNVYLPEDAEFYFTYDGSHQRHVMIAERIEDNVLQSSVPGHGLQETVTV      1 - 70
SVCLCSEGYSPVTMGSGSVTYVDNMACRLARLLVTQANRLTACSHQTLLTPFALTAGALPALDEELVLAL     71 - 140
THLELPLEWTVLGSSSLEVSSHRESLLHLAMRWGLAKLSQFFLCLPGGVQALALPNEEGATPLDLALREG    141 - 210
HSKLVEDVTNFQGRWSPSFSRVQLSEEASLHYIHSSETLTLTLNHTAEHLLEADIKLFRKYFWDRAFLVK    211 - 280
AFEPEARPEERTAMPSSGAETEEEIKNSVSSRSAAEKEDIKRVKSLVVQHNEHEDQHSLDLDRSFDILKK    281 - 350
SKPPSTLLAAGRLSDMLNGGDEVYANCMVIDQVGDLDISYINIEGITATTSPESRGCTLWPQSSKHTLPT    351 - 420
ETSPSVYPLSENVEGTAHTEAQQSFMSPSSSCASNLNLSFGWHGFEKEQSHLKKRSSSLDALDADSEGEG    421 - 490
HSEPSHICYTPGSQSSSRTGIPSGDELDSFETNTEPDFNISRAESLPLSSNLQSKESLLSGVRSRSYSCS    491 - 560
SPKISLGKTRLVRELTVCSSSEEQRAYSLSEPPRENRIQEEEWDKYIIPAKSESEKYKVSRTFSFLMNRM    561 - 630
TSPRNKSKTKSKDAKDKEKLNRHQFAPGTFSGVLQCLVCDKTLLGKESLQCSNCNANVHKGCKDAAPACT    631 - 700
KKFQEKYNKNKPQTILGNSSFRDIPQPGLSLHPSSSVPVGLPTGRRETVGQVHPLSRSVPGTTLESFRRS    701 - 770
ATSLESESDHNSCRSRSHSDELLQSMGSSPSTESFIMEDVVDSSLWSDLSSDAQEFEAESWSLVVDPSFC    771 - 840
NRQEKDVIKRQDVIFELMQTEMHHIQTLFIMSEIFRKGMKEELQLDHSTVDKIFPCLDELLEIHRHFFYS    841 - 910
MKERRQESCAGSDRNFVIDRIGDILVQQFSEENASKMKKIYGEFCCHHKEAVNLFKELQQNKKFQNFIKL    911 - 980
RNSNLLARRRGIPECILLVTQRITKYPVLVERILQYTKERTEEHKDLRKALCLIKDMIATVDLKVNEYEK    981 - 1050
NQKWLEILNKIENKTYTKLKNGHVFRKQALMSEERTLLYDGLVYWKTATGRFKDILALLLTDVLLFLQEK   1051 - 1120
DQKYIFAAVDQKPSVISLQKLIAREVANEERGMFLISASSAGPEMYEIHTNSKEERNNWMRRIQQAVESC   1121 - 1190
PEEKGGRTSESDEDKRKAEARVAKIQQCQEILTNQDQQICAYLEEKLHIYAELGELSGFEDVHLEPHLLI   1191 - 1260
KPDPGEPPQAASLLAAALKEAESLQVAVKASQMGAVSQSCEDSCGDSVLADTLSSHDVPGSPTASLVTGG   1261 - 1330
REGRGCSDVDPGIQGVVTDLAVSDAGEKVECRNFPGSSQSEIIQAIQNLTRLLYSLQAALTIQDSHIEIH   1331 - 1400
RLVLQQQEGLSLGHSILRGGPLQDQKSRDADRQHEELANVHQLQHQLQQEQRRWLRRCEQQQRAQATRES   1401 - 1470
WLQERERECQSQEELLLRSRGELDLQLQEYQHSLERLREGQRLVEREQARMRAQQSLLGHWKHGRQRSLP   1471 - 1540
AVLLPGGPEVMELNRSESLCHENSFFINEALVQMSFNTFNKLNPSVIHQDATYPTTQSHSDLVRTSEHQV   1541 - 1610
DLKVDPSQPSNVSHKLWTAAGSGHQILPFHESSKDSCKNDLDTSHTESPTPHDSNSHRPQLQAFITEAKL   1611 - 1680
NLPTRTMTRQDGETGDGAKENIVYL                                                1681 - 1705
//

Text Mined References (23)

PMID Year Title
25922072 2015 Gastrin-stimulated G?13 Activation of Rgnef Protein (ArhGEF28) in DLD-1 Colon Carcinoma Cells.
24712971 2014 ARHGEF28 gene exon 6/intron 6 junction mutations in Chinese amyotrophic lateral sclerosis cohort.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23509962 2013 A genome-wide search for common SNP x SNP interactions on the risk of venous thrombosis.
23286752 2013 Detection of a novel frameshift mutation and regions with homozygosis within ARHGEF28 gene in familial amyotrophic lateral sclerosis.
22941224 2012 Co-aggregation of RNA binding proteins in ALS spinal motor neurons: evidence of a common pathogenic mechanism.
21502573 2011 Genetic predictors of fibrin D-dimer levels in healthy adults.
21224360 2011 p190RhoGEF (Rgnef) promotes colon carcinoma tumor progression via interaction with focal adhesion kinase.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20200978 2010 Replication of previous genome-wide association studies of bone mineral density in premenopausal American women.
19488899 2010 Human low molecular weight neurofilament (NFL) mRNA interacts with a predicted p190RhoGEF homologue (RGNEF) in humans.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17993462 2008 Delta-catenin-induced dendritic morphogenesis. An essential role of p190RhoGEF interaction through Akt1-mediated phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12056414 2002 Characterization of size-fractionated cDNA libraries generated by the in vitro recombination-assisted method.
11058585 2001 Characterization of p190RhoGEF, a RhoA-specific guanine nucleotide exchange factor that interacts with microtubules.
10574993 1999 Interaction of c-Jun amino-terminal kinase interacting protein-1 with p190 rhoGEF and its localization in differentiated neurons.
9199174 1997 Identification of a novel, putative Rho-specific GDP/GTP exchange factor and a RhoA-binding protein: control of neuronal morphology.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.