Property Summary

NCBI Gene PubMed Count 68
PubMed Score 47.40
PubTator Score 189.28

Knowledge Summary

Patent

No data available

Expression

Gene RIF (37)

PMID Text
26866809 regulation of c-Src trafficking requires both microtubules and actin polymerization, and GEF-H1 coordinates c-Src trafficking, acting as a molecular switch between these two mechanisms
26820534 this study reports the crystal structure of human GEF-H1 PH domain to 2.45 A resolution.
26759237 By stimulating cofilin/PP2A-mediated dephosphorylation of the guanine nucleotide exchange factor GEF-H1.
26359301 data suggest that the induction of SGK1 through treatment with dexamethasone alters MT dynamics to increase Sec5-GEF-H1 interactions, which promote GEF-H1 targeting to adhesion sites.
25687035 Results supported that miR-512-3p could inhibit tumor cell adhesion, migration, and invasion by regulating the RAC1 activity via DOCK3 in NSCLC A549 and H1299 cell lines.
25143398 TGF-beta regulates LARG and GEF-H1 during epithelial-mesenchymal transition to affect stiffening response to force and cell invasion.
24706358 Paxillin-GEF-H1-p42/44-MAPK module as a regulator of pathological mechanotransduction.
24525234 The RhoGEF GEF-H1 is required for oncogenic RAS signaling via KSR-1.
24352660 This study investigated a novel mechanism of vascular barrier protection by ANP via modulation of GEF-H1 function.
24043311 ERK binds to the Rho exchange factor GEF-H1 and phosphorylates it on S959, causing inhibition of GEF-H1 activity and a consequent decrease in RhoA activity.
23432781 CAMSAP3-anchored non-centrosomal microtubules capture GEF-H1 more efficiently than other microtubules do.
23057787 vincristine activates GEF-H1/RhoA/ROCK/MLC signaling.
22898781 present evidence that depletion of GEF-H1, a guanine nucleotide exchange factor for Rho proteins, affects vesicle trafficking
22847784 Our findings underscore a potent oncogenic role for GEF-H1 in promoting the metastatic potentials of hepatocellular carcinoma, possibly through activation of RhoA signalling.
22593214 extracellular matrix stiffness regulates RhoA through microtubule destabilization and the subsequent release and activation of GEF-H1.
22513363 Data indicate that highly aggressive spindle-shaped 231BR3 cells changed to a round cell morphology associated with expression of the small GTPase guanine nucleotide exchange factor-H1 (GEF-H1).
22301607 LPS rapidly upregulates GEF-H1 expression. Activated Rho-associated kinase by GEF-H1 subsequently activates p38 and ERK1/2, thereby increasing IL-6/TNF-alpha expression in endothelial cells.
22226621 Lipopolysaccharide-induced ICAM-1 synthesis in human umbilical vein endothelial cells is regulated by GEF-H1/RhoA-dependent signaling pathway via activation of p38 and NF-kappaB.
22226472 Results show that LPS-induced NF-kappaB activation and IL-8 synthesis in endothelial cells are regulated by the MyD88 pathway and GEF-H1-RhoA pathway.
22072711 Polarity-regulating kinase partitioning-defective 1b (PAR1b) phosphorylates guanine nucleotide exchange factor H1 (GEF-H1) to regulate RhoA-dependent actin cytoskeletal reorganization.
22002306 Study shows that hPTTG1 is a transcription factor that triggers the GEF-H1/RhoA pathway to accelerate breast cancer invasion and metastasis. In human invasive breast carcinoma, hPTTG1 is overexpressed and is correlated to GEF-H1 expression.
21887730 GEF-H1 mediated the activation of Rip2 during signaling by NOD2, but not in the presence of the 3020insC variant of NOD2 associated with Crohn's disease. GEF-H1 functioned downstream of NOD2 as part of Rip2-containing signaling complexes.
21513698 These data suggest that Par1b-phosphorylation regulates turnover of GEF-H1 localization by regulating its interaction with microtubules, which may contribute to cell polarization.
21352810 GEFH1 was identified as binding partner for the BAR domain of ASAP1.GEFH1 is a negative regulator of podosomes.
21212278 the TNF-alpha-induced activation of the ERK/GEF-H1/RhoA pathway in tubular cells is mediated through Src- and TACE-dependent EGFR activation.
20803552 GEF-H1 is a new component of a syndecan signaling complex that is differentially expressed in brain metastatic melanoma cells compared to corresponding non-metastatic counterparts
20558775 Heparin inhibits pulmonary artery smooth muscle cell proliferation through GEF-H1/RhoA/ROCK/p27 signaling pathway.
20089843 Data indicate that GEF-H1 is a target and functional effector of TGF-beta by orchestrating Rho signaling to regulate gene expression and cell migration.
19911011 Observational study of gene-disease association. (HuGE Navigator)
19667072 Lfc is a phosphorylated protein and demonstrate that 14-3-3 interacts directly and in a phosphorylation-dependent manner with Lfc.
19625450 This study establishes GEF-H1 as a critical organizer of key structural and signaling components of cell migration through the localized regulation of RhoA activity at the cell leading edge.
18287519 These studies reveal a critical role for a GEF-H1/RhoA/ROCK/MLC signaling pathway in mediating nocodazole-induced cell contractility.
18095154 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17488622 These results identify a GEF-H1-dependent mechanism to modulate localized RhoA activation during cytokinesis under the control of mitotic kinases.
16778209 GEF-H1 expression level strongly correlated with p53 status in a panel of 32 cancer cell lines, and GEF-H1 induction caused activation of RhoA. Growth of mutant p53 cells was dependent on GEF-H1 expression.
15827085 PAK4 mediates morphological changes through regulation of GEF-H1
11912491 GEF-H1 is regulated by an interaction with microtubules.

AA Sequence

MSRIESLTRARIDRSRELASKTREKEKMKEAKDARYTNGHLFTTISVSGMTMCYACNKSITAKEALICPT      1 - 70
CNVTIHNRCKDTLANCTKVKQKQQKAALLKNNTALQSVSLRSKTTIRERPSSAIYPSDSFRQSLLGSRRG     71 - 140
RSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNMRNRTLSVESLIDEAEVIYSELMSDFEMDEK    141 - 210
DFAADSWSLAVDSSFLQQHKKEVMKQQDVIYELIQTELHHVRTLKIMTRLFRTGMLEELHLEPGVVQGLF    211 - 280
PCVDELSDIHTRFLSQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALK    281 - 350
LYKELYARDKRFQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLLISRILQHSHGIEEERQDLTTALG    351 - 420
LVKELLSNVDEGIYQLEKGARLQEIYNRMDPRAQTPVPGKGPFGREELLRRKLIHDGCLLWKTATGRFKD    421 - 490
VLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFLISAAPPEMYEVHTASRDDRS    491 - 560
TWIRVIQQSVRTCPSREDFPLIETEDEAYLRRIKMELQQKDRALVELLREKVGLFAEMTHFQAEEDGGSG    561 - 630
MALPTLPRGLFRSESLESPRGERLLQDAIREVEGLKDLLVGPGVELLLTPREPALPLEPDSGGNTSPGVT    631 - 700
ANGEARTFNGSIELCRADSDSSQRDRNGNQLRSPQEEALQRLVNLYGLLHGLQAAVAQQDTLMEARFPEG    701 - 770
PERREKLCRANSRDGEAGRAGAAPVAPEKQATELALLQRQHALLQEELRRCRRLGEERATEAGSLEARLR    771 - 840
ESEQARALLEREAEEARRQLAALGQTEPLPAEAPWARRPVDPRRRSLPAGDALYLSFNPPQPSRGTDRLD    841 - 910
LPVTTRSVHRNFEDRERQELGSPEERLQDSSDPDTGSEEEGSSRLSPPHSPRDFTRMQDIPEETESRDGE    911 - 980
AVASES                                                                    981 - 986
//

Text Mined References (87)

PMID Year Title
26866809 2016 Microtubule and Actin Interplay Drive Intracellular c-Src Trafficking.
26820534 2016 Crystal structure of hGEF-H1 PH domain provides insight into incapability in phosphoinositide binding.
26759237 2016 RASSF1A Suppresses the Invasion and Metastatic Potential of Human Non-Small Cell Lung Cancer Cells by Inhibiting YAP Activation through the GEF-H1/RhoB Pathway.
26359301 2015 Dexamethasone-induced cellular tension requires a SGK1-stimulated Sec5-GEF-H1 interaction.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25687035 2015 Inhibition of RAC1-GEF DOCK3 by miR-512-3p contributes to suppression of metastasis in non-small cell lung cancer.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25416956 2014 A proteome-scale map of the human interactome network.
25143398 2014 TGF-? regulates LARG and GEF-H1 during EMT to affect stiffening response to force and cell invasion.
24706358 2014 Paxillin mediates stretch-induced Rho signaling and endothelial permeability via assembly of paxillin-p42/44MAPK-GEF-H1 complex.
24525234 2014 The RhoGEF GEF-H1 is required for oncogenic RAS signaling via KSR-1.
24352660 2014 Control of vascular permeability by atrial natriuretic peptide via a GEF-H1-dependent mechanism.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24043311 2013 Extracellular signal-regulated kinase regulates RhoA activation and tumor cell plasticity by inhibiting guanine exchange factor H1 activity.
23432781 2013 Non-centrosomal microtubules regulate F-actin organization through the suppression of GEF-H1 activity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23057787 2012 Vincristine enhances amoeboid-like motility via GEF-H1/RhoA/ROCK/Myosin light chain signaling in MKN45 cells.
22959728 2013 Age of onset of amyotrophic lateral sclerosis is modulated by a locus on 1p34.1.
22898781 2012 The microtubule-associated Rho activating factor GEF-H1 interacts with exocyst complex to regulate vesicle traffic.
22847784 2012 GEF-H1 over-expression in hepatocellular carcinoma promotes cell motility via activation of RhoA signalling.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22593214 2012 Microtubules regulate GEF-H1 in response to extracellular matrix stiffness.
22513363 2012 Heparanase-induced GEF-H1 signaling regulates the cytoskeletal dynamics of brain metastatic breast cancer cells.
22301607 2012 Guanine-nucleotide exchange factor H1 mediates lipopolysaccharide-induced interleukin 6 and tumor necrosis factor ? expression in endothelial cells via activation of nuclear factor ?B.
22226621 2012 GEF-H1/RhoA signalling pathway mediates lipopolysaccharide-induced intercellular adhesion molecular-1 expression in endothelial cells via activation of p38 and NF-?B.
22226472 2012 GEF-H1-RhoA signaling pathway mediates LPS-induced NF-?B transactivation and IL-8 synthesis in endothelial cells.
22072711 2011 Polarity-regulating kinase partitioning-defective 1b (PAR1b) phosphorylates guanine nucleotide exchange factor H1 (GEF-H1) to regulate RhoA-dependent actin cytoskeletal reorganization.
22002306 2012 Overexpressed hPTTG1 promotes breast cancer cell invasion and metastasis by regulating GEF-H1/RhoA signalling.
21887730 2012 Control of NOD2 and Rip2-dependent innate immune activation by GEF-H1.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
21513698 2011 Dynamic regulation of GEF-H1 localization at microtubules by Par1b/MARK2.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21352810 2011 GEFH1 binds ASAP1 and regulates podosome formation.
21269460 2011 Initial characterization of the human central proteome.
21212278 2011 The epidermal growth factor receptor mediates tumor necrosis factor-alpha-induced activation of the ERK/GEF-H1/RhoA pathway in tubular epithelium.
20803552 2010 Modulation of GEF-H1 induced signaling by heparanase in brain metastatic melanoma cells.
20558775 2011 Heparin inhibits pulmonary artery smooth muscle cell proliferation through guanine nucleotide exchange factor-H1/RhoA/Rho kinase/p27.
20089843 2010 The RhoA activator GEF-H1/Lfc is a transforming growth factor-beta target gene and effector that regulates alpha-smooth muscle actin expression and cell migration.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19911011 2010 Mutation of ARHGAP9 in patients with coronary spastic angina.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19667072 2009 Modulation of Rho guanine exchange factor Lfc activity by protein kinase A-mediated phosphorylation.
19625450 2009 Guanine nucleotide exchange factor-H1 regulates cell migration via localized activation of RhoA at the leading edge.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19043560 2008 GEF-H1 mediated control of NOD1 dependent NF-kappaB activation by Shigella effectors.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18394899 2008 Cellular functions of GEF-H1, a microtubule-regulated Rho-GEF: is altered GEF-H1 activity a crucial determinant of disease pathogenesis?
18287519 2008 GEF-H1 couples nocodazole-induced microtubule disassembly to cell contractility via RhoA.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18211802 2008 ERK1/2 phosphorylate GEF-H1 to enhance its guanine nucleotide exchange activity toward RhoA.
18095154 2008 Use of expression data and the CGEMS genome-wide breast cancer association study to identify genes that may modify risk in BRCA1/2 mutation carriers.
18088087 2008 Phosphoproteome of resting human platelets.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17488622 2007 GEF-H1 modulates localized RhoA activation during cytokinesis under the control of mitotic kinases.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17314511 2007 Large-scale identification of c-MYC-associated proteins using a combined TAP/MudPIT approach.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16778209 2006 Mutant p53 induces the GEF-H1 oncogene, a guanine nucleotide exchange factor-H1 for RhoA, resulting in accelerated cell proliferation in tumor cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16381901 2006 The LIFEdb database in 2006.
15866167 2005 Binding of GEF-H1 to the tight junction-associated adaptor cingulin results in inhibition of Rho signaling and G1/S phase transition.
15827085 2005 PAK4 mediates morphological changes through the regulation of GEF-H1.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15161933 2004 Comprehensive proteomic analysis of interphase and mitotic 14-3-3-binding proteins.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14970201 2004 p21-activated kinase 1 phosphorylates and regulates 14-3-3 binding to GEF-H1, a microtubule-localized Rho exchange factor.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676191 2004 Comprehensive proteomic analysis of human Par protein complexes reveals an interconnected protein network.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12384139 2002 Ras and relatives--job sharing and networking keep an old family together.
12376548 2002 NRAGE, a p75 neurotrophin receptor-interacting protein, induces caspase activation and cell death through a JNK-dependent mitochondrial pathway.
11912491 2002 Nucleotide exchange factor GEF-H1 mediates cross-talk between microtubules and the actin cytoskeleton.
11756498 2002 Activation of Rac GTPase by p75 is necessary for c-jun N-terminal kinase-mediated apoptosis.
11595749 2001 Trp(56) of rac1 specifies interaction with a subset of guanine nucleotide exchange factors.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
9857026 1998 Cloning and characterization of GEF-H1, a microtubule-associated guanine nucleotide exchange factor for Rac and Rho GTPases.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
2466560 1989 Isolation and characterization of complementary DNA to proliferating cell nucleolar antigen P40.