Property Summary

NCBI Gene PubMed Count 54
PubMed Score 422.89
PubTator Score 58.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma 1.300 1.0e-05
astrocytic glioma -1.500 1.2e-02
ependymoma -1.800 1.5e-02
glioblastoma -2.300 4.7e-08
osteosarcoma -1.647 1.4e-06
medulloblastoma -1.800 4.6e-06
atypical teratoid / rhabdoid tumor -2.400 2.8e-08
medulloblastoma, large-cell -2.400 3.7e-07
primitive neuroectodermal tumor -1.200 2.8e-03
autosomal dominant Emery-Dreifuss muscul... 1.093 3.2e-03
hereditary spastic paraplegia -1.142 5.3e-03
acute quadriplegic myopathy 1.048 1.3e-04
intraductal papillary-mucinous neoplasm ... 1.200 4.4e-02
lung cancer 1.500 5.5e-03
adult high grade glioma -2.300 3.5e-06
pilocytic astrocytoma -1.600 5.8e-07
spina bifida -1.431 3.7e-02
mucosa-associated lymphoid tissue lympho... 1.487 5.5e-03
ovarian cancer 1.600 8.0e-04
pituitary cancer 1.200 6.5e-05

Protein-protein Interaction (7)

Gene RIF (33)

PMID Text
26627240 Two related guanine nucleotide exchange factors (GEFs), PDZ-RhoGEF and leukemia-associated RhoGEF (LARG), use their PDZ domains to bind class B plexins and play critical roles in signaling.
26483157 that leukemia-associated Rho guanine-nucleotide exchange factor can be directly phosphorylated by cyclin-dependent kinase 1
25637523 this study identified a novel association between IOP and ARHGEF12.
25143398 TGF-beta regulates LARG and GEF-H1 during epithelial-mesenchymal transition to affect stiffening response to force and cell invasion.
24585879 Data indicate that ICAM-1 signaling activates leukemia-associated Rho guanine nucleotide exchange factor (LARG), also known as Rho GEF 12 (ARHGEF12).
24106280 Agonist-induced Ca2+ sensitization in smooth muscle: redundancy of Rho guanine nucleotide exchange factors (RhoGEFs) and response kinetics, a caged compound study.
23885121 LARG is a novel and temporally distinct Rho Guanine Nucleotide Exchange Factor required for completion of abscission.
23207522 RhoGEF activity of p210 BCR/ABL directly contributes to transforming activity, and may account for the difference in disease outcome associated with p190 BCR/ABL and p210 BCR/ABL.
22962269 NIS enhanced cell migration and invasion by binding to leukemia-associated RhoA guanine exchange factor
22190034 HIV-1 PR is identified to have a physical interaction with Rho guanine nucleotide exchange factor (GEF) 12 (ARHGEF12) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22100544 The PDZ domain of LARG is required HRH1-mediated activation of the strictly Rho-dependent transcriptional activity of serum response factor and can be mimicked by activated Galpha(q)(Q209L).
21454492 Mechanistic insights into specificity, activity, and regulatory elements of the regulator of G-protein signaling (RGS)-containing Rho-specific guanine nucleotide exchange factors (GEFs) p115, PDZ-RhoGEF (PRG), and leukemia-associated RhoGEF (LARG).
20800603 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20348106 a novel physical and functional interaction between ABCA1 and PDZ-RhoGEF/LARG, which activates RhoA, resulting in ABCA1 stabilization and cholesterol efflux activity.
19911011 Observational study of gene-disease association. (HuGE Navigator)
19734946 LARG at chromosome 11q23 has functional characteristics of a tumor suppressor in human breast and colorectal cancer
19560536 mutations in the hydrophobic patch do not have a significant effect on in vitro activity, but abolished the ability of LARG to activate RhoA and to induce stress fiber formation in cultured cells.
19273616 Moreover, leukemia-associated guanine nucleotide exchange factor (LARG) associates with Unc5B to transduce the RhoA signal.
19074425 LARG activation is regulated by an induced-fit mechanism through the GAP interface of Galpha(13).
18411422 Analysis of the (15)N relaxation data using reduced spectral density mapping shows that the apo LARG PDZ is flexible and exhibits internal motions on both picosecond to nanosecond and microsecond to millisecond timescales
18187620 Knockdown of Rho guanine nucleotide exchange factor 12 (ARHGEF12) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17766704 Observational study of gene-disease association. (HuGE Navigator)
17766704 There is no evidence in the Caucasian KORA study that variants of the LARG gene confer susceptibility for type 2 diabetes, insulin sensitivity, or the metabolic syndrome
16644711 Observational study of gene-disease association. (HuGE Navigator)
16644711 Tyr1306Cys substitution in LARG, through its differential activation of RhoA, increases insulin sensitivity in nondiabetic Pima Indians.
16565089 CD44 interaction with LARG and EGFR plays a pivotal role in Rho/Ras co-activation, PLC epsilon-Ca2+ signaling, and Raf/ERK up-regulation required for CaMKII-mediated cytoskeleton function and in head and neck squamous cell carcinoma progression
15331592 analysis of LARG RhoA binding and nucleotide exchange structure
15143072 Data show that different rho guanine nucleotide exchange factors (rhoGEFs; p115rhoGEF, LARG and PDZrhoGEF) mediate downstream rho signaling by the thrombin and lysophosphatidic acid receptors.
12515866 Rho activation through Galpha12 and the regulation of RhoGEFs by heterotrimeric G proteins G1213 is further modulated by tyrosine phosphorylated leukemia-associated RhoGEF.
12196628 LARG plays a critical role in plexin-B1 signaling to stimulate Rho activation and cytoskeletal reorganization.
12183458 Plexin B regulates Rho through the guanine nucleotide exchange factors leukemia-associated protein and PDZ-RhoGEF.
11799111 Regulation of G protein-linked guanine nucleotide exchange factors for Rho, PDZ-RhoGEF, and LARG by tyrosine phosphorylation: evidence of a role for focal adhesion kinase

AA Sequence

MSGTQSTITDRFPLKKPIRHGSILNRESPTDKKQKVERIASHDFDPTDSSSKKTKSSSEESRSEIYGLVQ      1 - 70
RCVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHLEVVKLIKSGSYV     71 - 140
ALTVQGRPPGSPQIPLADSEVEPSVIGHMSPIMTSPHSPGASGNMERITSPVLMGEENNVVHNQKVEILR    141 - 210
KMLQKEQERLQLLQEDYNRTPAQRLLKEIQEAKKHIPQLQEQLSKATGSAQDGAVVTPSRPLGDTLTVSE    211 - 280
AETDPGDVLGRTDCSSGDASRPSSDNADSPKSGPKERIYLEENPEKSETIQDTDTQSLVGSPSTRIAPHI    281 - 350
IGAEDDDFGTEHEQINGQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKHTNSKETRR    351 - 420
IFLEFHQFFLDRSAHLKVSVPDEMSADLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHLEDFRQKRSMG    421 - 490
LTLAESELTKLDAERDKDRLTLEKERTCAEQIVAKIEEVLMTAQAVEEDKSSTMQYVILMYMKHLGVKVK    491 - 560
EPRNLEHKRGRIGFLPKIKQSMKKDKEGEEKGKRRGFPSILGPPRRPSRHDNSAIGRAMELQKARHPKHL    561 - 630
STPSSVSPEPQDSAKLRQSGLANEGTDAGYLPANSMSSVASGASFSQEGGKENDTGSKQVGETSAPGDTL    631 - 700
DGTPRTLNTVFDFPPPPLDQVQEEECEVERVTEHGTPKPFRKFDSVAFGESQSEDEQFENDLETDPPNWQ    701 - 770
QLVSREVLLGLKPCEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQ    771 - 840
LHIGLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQT    841 - 910
FVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPTEREKVKKAADHCRQILNYVNQAVKE    911 - 980
AENKQRLEDYQRRLDTSSLKLSEYPNVEELRNLDLTKRKMIHEGPLVWKVNRDKTIDLYTLLLEDILVLL    981 - 1050
QKQDDRLVLRCHSKILASTADSKHTFSPVIKLSTVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEK   1051 - 1120
TVWQDLICRMAASVKEQSTKPIPLPQSTPGEGDNDEEDPSKLKEEQHGISVTGLQSPDRDLGLESTLISS   1121 - 1190
KPQSHSLSTSGKSEVRDLFVAERQFAKEQHTDGTLKEVGEDYQIAIPDSHLPVSEERWALDALRNLGLLK   1191 - 1260
QLLVQQLGLTEKSVQEDWQHFPRYRTASQGPQTDSVIQNSENIKAYHSGEGHMPFRTGTGDIATCYSPRT   1261 - 1330
STESFAPRDSVGLAPQDSQASNILVMDHMIMTPEMPTMEPEGGLDDSGEHFFDAREAHSDENPSEGDGAV   1331 - 1400
NKEEKDVNLRISGNYLILDGYDPVQESSTDEEVASSLTLQPMTGIPAVESTHQQQHSPQNTHSDGAISPF   1401 - 1470
TPEFLVQQRWGAMEYSCFEIQSPSSCADSQSQIMEYIHKIEADLEHLKKVEESYTILCQRLAGSALTDKH   1471 - 1540
SDKS                                                                     1541 - 1544
//

Text Mined References (65)

PMID Year Title
27298323 2016 Local RhoA activation induces cytokinetic furrows independent of spindle position and cell cycle stage.
26627240 2015 Secondary PDZ domain-binding site on class B plexins enhances the affinity for PDZ-RhoGEF.
26483157 2016 Mitotic-dependent phosphorylation of leukemia-associated RhoGEF (LARG) by Cdk1.
25637523 2015 ARHGEF12 influences the risk of glaucoma by increasing intraocular pressure.
25173105 2014 Common variants near ABCA1, AFAP1 and GMDS confer risk of primary open-angle glaucoma.
25143398 2014 TGF-? regulates LARG and GEF-H1 during EMT to affect stiffening response to force and cell invasion.
24585879 2014 The RhoA guanine nucleotide exchange factor, LARG, mediates ICAM-1-dependent mechanotransduction in endothelial cells to stimulate transendothelial migration.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24106280 2013 Agonist-induced Ca2+ sensitization in smooth muscle: redundancy of Rho guanine nucleotide exchange factors (RhoGEFs) and response kinetics, a caged compound study.
23885121 2013 Leukemia-associated RhoGEF (LARG) is a novel RhoGEF in cytokinesis and required for the proper completion of abscission.
23207522 2013 Contributions of the RhoGEF activity of p210 BCR/ABL to disease progression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22962269 2012 Iodide transporter NIS regulates cancer cell motility and invasiveness by interacting with the Rho guanine nucleotide exchange factor LARG.
22100544 2012 LARG links histamine-H1-receptor-activated Gq to Rho-GTPase-dependent signaling pathways.
21454492 2011 Mechanistic insights into specificity, activity, and regulatory elements of the regulator of G-protein signaling (RGS)-containing Rho-specific guanine nucleotide exchange factors (GEFs) p115, PDZ-RhoGEF (PRG), and leukemia-associated RhoGEF (LARG).
21269460 2011 Initial characterization of the human central proteome.
20844236 2010 HGAL, a germinal center specific protein, decreases lymphoma cell motility by modulation of the RhoA signaling pathway.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20702813 2010 Sphingosine 1-phosphate receptor 2 signals through leukemia-associated RhoGEF (LARG), to promote smooth muscle cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20348106 2010 Binding of PDZ-RhoGEF to ATP-binding cassette transporter A1 (ABCA1) induces cholesterol efflux through RhoA activation and prevention of transporter degradation.
20300064 2010 A bacterial effector targets host DH-PH domain RhoGEFs and antagonizes macrophage phagocytosis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20018869 2010 Real-time NMR study of guanine nucleotide exchange and activation of RhoA by PDZ-RhoGEF.
19911011 2010 Mutation of ARHGAP9 in patients with coronary spastic angina.
19734946 2009 LARG at chromosome 11q23 has functional characteristics of a tumor suppressor in human breast and colorectal cancer.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19560536 2009 A conserved hydrophobic surface of the LARG pleckstrin homology domain is critical for RhoA activation in cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19273616 2009 Unc5B associates with LARG to mediate the action of repulsive guidance molecule.
19074425 2009 Activation of leukemia-associated RhoGEF by Galpha13 with significant conformational rearrangements in the interface.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18411422 2008 Conformational change upon ligand binding and dynamics of the PDZ domain from leukemia-associated Rho guanine nucleotide exchange factor.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18088087 2008 Phosphoproteome of resting human platelets.
17766704 2007 Genetic variants in the leukemia-associated Rho guanine nucleotide exchange factor (ARHGEF12) gene are not associated with T2DM and related parameters in Caucasians (KORA study).
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16644711 2006 A functional Tyr1306Cys variant in LARG is associated with increased insulin action in vivo.
16565089 2006 Hyaluronan-CD44 interaction with leukemia-associated RhoGEF and epidermal growth factor receptor promotes Rho/Ras co-activation, phospholipase C epsilon-Ca2+ signaling, and cytoskeleton modification in head and neck squamous cell carcinoma cells.
16192274 2005 Crystal structures of Delta1-piperideine-2-carboxylate/Delta1-pyrroline-2-carboxylate reductase belonging to a new family of NAD(P)H-dependent oxidoreductases: conformational change, substrate recognition, and stereochemistry of the reaction.
16192269 2005 Purification of ATP-binding cassette transporter A1 and associated binding proteins reveals the importance of beta1-syntrophin in cholesterol efflux.
15755723 2005 Physical and functional interactions of the lysophosphatidic acid receptors with PDZ domain-containing Rho guanine nucleotide exchange factors (RhoGEFs).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15364580 2004 Inter-domain motions of the N-domain of the KdpFABC complex, a P-type ATPase, are not driven by ATP-induced conformational changes.
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15331592 2004 Structural determinants of RhoA binding and nucleotide exchange in leukemia-associated Rho guanine-nucleotide exchange factor.
15143072 2004 Thrombin and lysophosphatidic acid receptors utilize distinct rhoGEFs in prostate cancer cells.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
12515866 2003 Galpha 12 activates Rho GTPase through tyrosine-phosphorylated leukemia-associated RhoGEF.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12376551 2002 RhoG signals in parallel with Rac1 and Cdc42.
12376548 2002 NRAGE, a p75 neurotrophin receptor-interacting protein, induces caspase activation and cell death through a JNK-dependent mitochondrial pathway.
12372594 2002 B plexins activate Rho through PDZ-RhoGEF.
12220504 2002 Interaction of plexin-B1 with PDZ domain-containing Rho guanine nucleotide exchange factors.
12196628 2002 The semaphorin receptor plexin-B1 signals through a direct interaction with the Rho-specific nucleotide exchange factor, LARG.
12183458 2002 Plexin B regulates Rho through the guanine nucleotide exchange factors leukemia-associated Rho GEF (LARG) and PDZ-RhoGEF.
12123608 2002 Plexin-B1 directly interacts with PDZ-RhoGEF/LARG to regulate RhoA and growth cone morphology.
11799111 2002 Regulation of G protein-linked guanine nucleotide exchange factors for Rho, PDZ-RhoGEF, and LARG by tyrosine phosphorylation: evidence of a role for focal adhesion kinase.
11756498 2002 Activation of Rac GTPase by p75 is necessary for c-jun N-terminal kinase-mediated apoptosis.
11724822 2001 Direct interaction of insulin-like growth factor-1 receptor with leukemia-associated RhoGEF.
11373293 2001 Leukemia-associated Rho guanine nucleotide exchange factor, a Dbl family protein found mutated in leukemia, causes transformation by activation of RhoA.
11094164 2000 Leukemia-associated Rho guanine nucleotide exchange factor (LARG) links heterotrimeric G proteins of the G(12) family to Rho.
10681437 2000 Identification of a gene at 11q23 encoding a guanine nucleotide exchange factor: evidence for its fusion with MLL in acute myeloid leukemia.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.