Property Summary

NCBI Gene PubMed Count 49
PubMed Score 765.39
PubTator Score 42.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.257 2.0e-05
ovarian cancer -2.000 6.4e-05

Protein-protein Interaction (153)

ARHGAP10   ARHGAP32   GNAT3   MYO9A   ARHGAP33   RASGRF2   MCF2L   ARHGEF11   ARHGAP6   SRGAP3   ARHGEF9   KALRN   SRGAP2   ROCK2   TRIO   PLEKHG5   FAM13A   S1PR2   S1PR4   SAA1   ADORA3   CXCL8   MCF2   CHN1   ADRA2C   CXCR5   CCR2   ARHGAP25   CXCL12   CXCR3   CCR9   CHN2   CCL23   TAS2R38   TAS2R39   TAS2R40   TAS2R41   TAS2R43   TAS2R31   TAS2R45   TAS2R46   TAS2R30   TAS2R19   TAS2R20   TAS2R50   TAS2R60   GNG2   CDC42   CXCR4   RAC1   ARHGAP8   ARHGAP4   OCRL   AKAP13   ABR   TIAM1   ARHGAP5   MYO9B   ROCK1   ARHGEF7   ARHGAP19   RALBP1   ITSN1   ARHGAP44   ARHGAP31   ARHGAP11B   ARHGAP29   ARHGAP15   NMS   FGD3   ARHGAP21   ARHGAP40   OBSCN   SYDE2   ARHGEF16   ARHGAP17   ARHGAP11A   ARHGAP36   ARHGEF18   SYDE1   RHOU   TAS2R42   ARHGAP22   NET1   SRGAP1   ARHGAP30   FGD2   TIAM2   MT-RNR2   ARHGEF19   ARHGAP12   RHOT2   RHOT1   TAGAP   ARHGAP24   ARHGAP18   NGEF   NPW   NPB   PREX1   HCAR2   OXER1   RXFP4   DEPDC1B   ARAP3   RLN3   ARAP2   ARHGAP45   ARHGEF2   MCHR2   ARHGEF26   RHOV   FGD4   ARAP1   OXGR1   ARHGEF17   DEPDC7   P2RY13   ARHGAP9   SUCNR1   HCAR1   NMUR2   RACGAP1   LPAR5   S1PR5   RHOJ   PLEKHG2   ECT2   NMUR1   ARHGEF4   ARHGEF3   HEBP1   ARHGAP35   FAM13B   TAS2R16   TAS2R14   TAS2R13   TAS2R10   TAS2R9   TAS2R8   TAS2R7   TAS2R5   TAS2R4   TAS2R3   TAS2R1   ARHGEF12   GMIP   ARHGAP23   ARHGAP20   ARHGAP28   VAV3   GPR55   STARD13  

Gene RIF (27)

PMID Text
25916117 contactin-1 displayed the ability to phosphorylate the RhoA activator p115 RhoGEF
24855647 Regulated localization is sufficient for hormonal control of regulator of G protein signaling homology Rho guanine nucleotide exchange factors (RH-RhoGEFs).
24465552 The novel role for p115RhoGEF in regulation of epithelial plasticity is dependent on Rho-DRF signaling module.
23816534 Modification of p115RhoGEF at Serine(330) regulates its RhoGEF activity.
23718289 The action of DOCK7 in vivo may involve the coordinated integration of Cdc42/Rac1 signaling in the context of the membrane recruitment of a DOCK7 guanine nucleotide exchange factor (GEF) complex.
23705972 The interaction of the long cytoplasmic tail of HIV-1 gp41 with the carboxy-terminal regulatory domain of p115-RhoGEF inhibits p115-mediated actin stress fiber formation and activation of serum response factor (SRF)
23077317 The interaction of the long cytoplasmic tail of HIV-1 gp41 with the carboxy-terminal regulatory domain of p115-RhoGEF inhibits p115-mediated actin stress fiber formation and activation of serum response factor (SRF)
23070684 High GEF1 expression is associated with metastasis of pancreatic cancer.
22661716 Activation of p115-RhoGEF requires direct association of Galpha13 and the Dbl homology domain.
22500016 Upon beta(2)AR activation, both betaArrestin2 and p115RhoGEF translocate to the plasma membrane, with concomitant activation of RhoA and formation of focal adhesions and stress fibers.
22086927 Thromboxane receptor signaling is required for fibronectin-induced matrix metalloproteinase 9 production by human and murine macrophages and is attenuated by the Arhgef1 molecule.
21454492 Mechanistic insights into specificity, activity, and regulatory elements of the regulator of G-protein signaling (RGS)-containing Rho-specific guanine nucleotide exchange factors (GEFs) p115, PDZ-RhoGEF (PRG), and leukemia-associated RhoGEF (LARG).
21064165 The linker region connecting the N-terminal RGS-homology domain and the Dbl homology domain inhibits the intrinsic guanine nucleotide exchange activity of p115.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20619149 ARHGEF1 is involed in hypertension by controlling its molecular mechanisms.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19911011 Observational study of gene-disease association. (HuGE Navigator)
19720875 Data show that microtubules in neighboring cells reorient and target p115 RhoGEF to sites where dying cells are squeezed out of the epithelial sheet.
18320579 A pronounced and rapid translocation of p115-RhoGEF from the cytosol to the plasma membrane was observed upon activation of several G(12/13)-coupled receptors in a cell type-independent fashion.
17493936 analysis of a novel cross-talk exerted from the LPA/Galpha(13)/p115RhoGEF/RhoA pathway to the beta(2)-adrenergic receptor/Galpha(s)/adenylyl cyclase pathway
15735747 Several features of a typical alpha/RGS interaction are preserved in the alpha(13)/p115RhoGEF interaction.
15143072 Data show that different rho guanine nucleotide exchange factors (rhoGEFs; p115rhoGEF, LARG and PDZrhoGEF) mediate downstream rho signaling by the thrombin and lysophosphatidic acid receptors.
12754211 data demonstrate a pathway of Rho activation involving protein kinase c alpha-dependent phosphorylation of p115Rho guanine exchange factor
12748184 CD44 interaction with p115RhoGEF and ROK plays a pivotal role in promoting Gab-1 phosphorylation leading to Gab-1.PI 3-kinase membrane localization, AKT signaling, and cytokine (M-CSF) production during HA-mediated breast cancer progression
12525488 rgRGS domain may serve a structural or allosteric role in the regulation of the nucleotide exchange activity of p115RhoGEF on Rho by Galpha(13)
12372594 coexpression of a dominant negative PDZ-RhoGEF abrogated the ability of plexin-B1 to cause stress fiber formation
10556093 The interaction of the long cytoplasmic tail of HIV-1 gp41 with the carboxy-terminal regulatory domain of p115-RhoGEF inhibits p115-mediated actin stress fiber formation and activation of serum response factor (SRF)

AA Sequence

MEDFARGAASPGPSRPGLVPVSIIGAEDEDFENELETNSEEQNSQFQSLEQVKRRPAHLMALLQHVALQF      1 - 70
EPGPLLCCLHADMLGSLGPKEAKKAFLDFYHSFLEKTAVLRVPVPPNVAFELDRTRADLISEDVQRRFVQ     71 - 140
EVVQSQQVAVGRQLEDFRSKRLMGMTPWEQELAQLEAWVGRDRASYEARERHVAERLLMHLEEMQHTIST    141 - 210
DEEKSAAVVNAIGLYMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPAKTKKGLSSILDAARWNRGEPQ    211 - 280
VPDFRHLKAEVDAEKPGATDRKGGVGMPSRDRNIGAPGQDTPGVSLHPLSLDSPDREPGADAPLELGDSS    281 - 350
PQGPMSLESLAPPESTDEGAETESPEPGDEGEPGRSGLELEPEEPPGWRELVPPDTLHSLPKSQVKRQEV    351 - 420
ISELLVTEAAHVRMLRVLHDLFFQPMAECLFFPLEELQNIFPSLDELIEVHSLFLDRLMKRRQESGYLIE    421 - 490
EIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFVQEAESRPRCRRLQLKDMIPT    491 - 560
EMQRLTKYPLLLQSIGQNTEEPTEREKVELAAECCREILHHVNQAVRDMEDLLRLKDYQRRLDLSHLRQS    561 - 630
SDPMLSEFKNLDITKKKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDG    631 - 700
KTMLRPVLRLTSAMTREVATDHKAFYVLFTWDQEAQIYELVAQTVSERKNWCALITETAGSLKVPAPASR    701 - 770
PKPRPSPSSTREPLLSSSENGNGGRETSPADARTERILSDLLPFCRPGPEGQLAATALRKVLSLKQLLFP    771 - 840
AEEDNGAGPPRDGDGVPGGGPLSPARTQEIQENLLSLEETMKQLEELEEEFCRLRPLLSQLGGNSVPQPG    841 - 910
CT                                                                        911 - 912
//

Text Mined References (60)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25916117 [Under hypoxia condition contactin-1 regulates migration of MKN45 cells through RhoA pathway].
25416956 2014 A proteome-scale map of the human interactome network.
24855647 2014 Regulated localization is sufficient for hormonal control of regulator of G protein signaling homology Rho guanine nucleotide exchange factors (RH-RhoGEFs).
24465552 2014 A novel role for p115RhoGEF in regulation of epithelial plasticity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23816534 2013 Modification of p115RhoGEF Ser(330) regulates its RhoGEF activity.
23718289 2013 Prenylation and membrane localization of Cdc42 are essential for activation by DOCK7.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23070684 2012 miR-143 inhibits the metastasis of pancreatic cancer and an associated signaling pathway.
22661716 2012 Activation of p115-RhoGEF requires direct association of G?13 and the Dbl homology domain.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22500016 2012 Acute activation of ?2-adrenergic receptor regulates focal adhesions through ?Arrestin2- and p115RhoGEF protein-mediated activation of RhoA.
22086927 2011 Thromboxane receptor signaling is required for fibronectin-induced matrix metalloproteinase 9 production by human and murine macrophages and is attenuated by the Arhgef1 molecule.
21454492 2011 Mechanistic insights into specificity, activity, and regulatory elements of the regulator of G-protein signaling (RGS)-containing Rho-specific guanine nucleotide exchange factors (GEFs) p115, PDZ-RhoGEF (PRG), and leukemia-associated RhoGEF (LARG).
21269460 2011 Initial characterization of the human central proteome.
21064165 2011 Modulation of a GEF switch: autoinhibition of the intrinsic guanine nucleotide exchange activity of p115-RhoGEF.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20619149 [The exchange factor Arhgef1: a new target in hypertension].
20300064 2010 A bacterial effector targets host DH-PH domain RhoGEFs and antagonizes macrophage phagocytosis.
20098430 2010 The Rho exchange factor Arhgef1 mediates the effects of angiotensin II on vascular tone and blood pressure.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19911011 2010 Mutation of ARHGAP9 in patients with coronary spastic angina.
19720875 2009 P115 RhoGEF and microtubules decide the direction apoptotic cells extrude from an epithelium.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18320579 2008 Reversible translocation of p115-RhoGEF by G(12/13)-coupled receptors.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17493936 2007 Lysophosphatidic acid regulates trafficking of beta2-adrenergic receptors: the Galpha13/p115RhoGEF/JNK pathway stimulates receptor internalization.
17335080 2007 Roles of glial p75NTR in axonal regeneration.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16215275 2005 Multiple signals regulate axon regeneration through the Nogo receptor complex.
15753034 2005 Association of CNK1 with Rho guanine nucleotide exchange factors controls signaling specificity downstream of Rho.
15735747 2005 Functional consequences of G alpha 13 mutations that disrupt interaction with p115RhoGEF.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15143072 2004 Thrombin and lysophosphatidic acid receptors utilize distinct rhoGEFs in prostate cancer cells.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14712228 2004 Homo- and hetero-oligomerization of PDZ-RhoGEF, LARG and p115RhoGEF by their C-terminal region regulates their in vivo Rho GEF activity and transforming potential.
12951563 2003 Myelin-associated inhibitors of axonal regeneration in the adult mammalian CNS.
12754211 2003 Protein kinase Calpha-induced p115RhoGEF phosphorylation signals endothelial cytoskeletal rearrangement.
12748184 2003 Hyaluronan-mediated CD44 interaction with RhoGEF and Rho kinase promotes Grb2-associated binder-1 phosphorylation and phosphatidylinositol 3-kinase signaling leading to cytokine (macrophage-colony stimulating factor) production and breast tumor progression.
12692556 2003 The p75 receptor acts as a displacement factor that releases Rho from Rho-GDI.
12681510 2003 Mutation of an N-terminal acidic-rich region of p115-RhoGEF dissociates alpha13 binding and alpha13-promoted plasma membrane recruitment.
12534370 2003 Characterization of G alpha 13-dependent plasma membrane recruitment of p115RhoGEF.
12525488 2003 Mapping the Galpha13 binding interface of the rgRGS domain of p115RhoGEF.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12372594 2002 B plexins activate Rho through PDZ-RhoGEF.
12270917 2002 Association of Lbc Rho guanine nucleotide exchange factor with alpha-catenin-related protein, alpha-catulin/CTNNAL1, supports serum response factor activation.
11524686 2001 Structure of the rgRGS domain of p115RhoGEF.
11384980 2001 Identification of potential mechanisms for regulation of p115 RhoGEF through analysis of endogenous and mutant forms of the exchange factor.
11358341 2001 Regulation of G protein-mediated signal transduction by RGS proteins.
11313914 2001 RGS-containing RhoGEFs: the missing link between transforming G proteins and Rho?
10747909 2000 Galpha 13 requires palmitoylation for plasma membrane localization, Rho-dependent signaling, and promotion of p115-RhoGEF membrane binding.
10648409 2000 Activation of the small GTPases, rac and cdc42, after ligation of the platelet PAR-1 receptor.
9641916 1998 Direct stimulation of the guanine nucleotide exchange activity of p115 RhoGEF by Galpha13.
9641915 1998 p115 RhoGEF, a GTPase activating protein for Galpha12 and Galpha13.
9135076 1997 Characterization, expression and chromosomal localization of a human gene homologous to the mouse Lsc oncogene, with strongest expression in hematopoetic tissues.
8810315 1996 Identification of a novel guanine nucleotide exchange factor for the Rho GTPase.