Property Summary

NCBI Gene PubMed Count 73
PubMed Score 99.33
PubTator Score 183.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
active Crohn's disease 1.035 4.7e-03
active ulcerative colitis 1.049 1.3e-02
adult high grade glioma 1.400 2.3e-03
astrocytoma 1.700 2.6e-02
Astrocytoma, Pilocytic 2.000 2.1e-07
Breast cancer 1.100 9.0e-03
cystic fibrosis 1.098 5.6e-05
dermatomyositis 1.500 2.1e-03
diabetes mellitus -1.200 1.3e-02
Duchenne muscular dystrophy 1.139 6.6e-10
ependymoma 1.300 1.3e-05
glioblastoma 1.400 4.6e-06
intraductal papillary-mucinous carcinoma... -1.100 1.2e-02
invasive ductal carcinoma 1.046 9.7e-03
juvenile dermatomyositis 1.300 6.3e-11
lung cancer -1.300 2.9e-03
lung carcinoma -2.000 1.0e-22
malignant mesothelioma 5.900 5.2e-10
non-small cell lung cancer -1.123 9.0e-11
osteosarcoma -1.788 1.5e-03
ovarian cancer -1.200 5.1e-04
pancreatic cancer 1.100 4.0e-03
primary Sjogren syndrome 1.200 1.1e-03
psoriasis 1.100 4.6e-05
Rheumatoid arthritis -1.600 2.3e-04
subependymal giant cell astrocytoma 1.686 1.1e-02
Waldenstrons macroglobulinemia 1.513 1.5e-02

Synonym

Accession P52566 B5BU79 Rho GDI 2
Symbols D4
GDIA2
GDID4
LYGDI
Ly-GDI
RAP1GN1
RhoGDI2

Gene

PDB

1DS6   5H1D  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (48)

AA Sequence

MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVT      1 - 70
RLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKAT     71 - 140
FMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE             141 - 201
//

Text Mined References (80)

PMID Year Title