Property Summary

Ligand Count 6
NCBI Gene PubMed Count 115
PubMed Score 370.13
PubTator Score 160.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia 1.300 3.9e-02
breast carcinoma 1.100 7.1e-09
COPD -1.400 8.5e-03
glioblastoma 1.200 2.3e-04
group 4 medulloblastoma 1.500 9.9e-03
lung cancer 1.100 1.3e-02
malignant mesothelioma -1.600 2.1e-06
medulloblastoma, large-cell 1.100 4.7e-04
non diabetic and post-ischemic heart fai... -1.100 2.9e-03
ovarian cancer 1.100 1.7e-05
pediatric high grade glioma 1.400 7.2e-03
Pick disease -1.300 1.1e-05
Polycystic ovary syndrome -1.773 1.3e-02
psoriasis -1.600 1.1e-04

PDB (20)

Gene RIF (58)

AA Sequence

MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNV      1 - 70
VVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKID     71 - 140
KTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD          141 - 204
//

Text Mined References (125)

PMID Year Title