Property Summary

NCBI Gene PubMed Count 14
PubMed Score 53.26
PubTator Score 96.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -3.988 2.4e-06
periodontitis 1.100 1.6e-28
non-small cell lung cancer -1.592 3.4e-16
intraductal papillary-mucinous neoplasm ... -1.100 2.7e-02
interstitial cystitis 2.400 9.6e-04
adult high grade glioma 1.100 5.5e-03
group 3 medulloblastoma 2.200 3.6e-04
primary Sjogren syndrome 1.600 7.6e-03
invasive ductal carcinoma 1.264 1.8e-03
spina bifida 1.174 1.7e-02
ulcerative colitis 2.100 4.1e-05

Gene RIF (2)

PMID Text
19911011 The Ala370Ser polymorphism in the ARHGAP9 gene is associated with coronary artery spasm.
19911011 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLSSRWWPSSWGILGLGPRSPPRGSQLCALYAFTYTGADGQQVSLAEGDRFLLLRKTNSDWWLARRLEAP      1 - 70
STSRPIFVPAAYMIEESIPSQSPTTVIPGQLLWTPGPKLFHGSLEELSQALPSRAQASSEQPPPLPRKMC     71 - 140
RSVSTDNLSPSLLKPFQEGPSGRSLSQEDLPSEASASTAGPQPLMSEPPVYCNLVDLRRCPRSPPPGPAC    141 - 210
PLLQRLDAWEQHLDPNSGRCFYINSLTGCKSWKPPRRSRSETNPGSMEGTQTLKRNNDVLQPQAKGFRSD    211 - 280
TGTPEPLDPQGSLSLSQRTSQLDPPALQAPRPLPQLLDDPHEVEKSGLLNMTKIAQGGRKLRKNWGPSWV    281 - 350
VLTGNSLVFYREPPPTAPSSGWGPAGSRPESSVDLRGAALAHGRHLSSRRNVLHIRTIPGHEFLLQSDHE    351 - 420
TELRAWHRALRTVIERLVRWVEARREAPTGRDQGSGDRENPLELRLSGSGPAELSAGEDEEEESELVSKP    421 - 490
LLRLSSRRSSIRGPEGTEQNRVRNKLKRLIAKRPPLQSLQERGLLRDQVFGCQLESLCQREGDTVPSFLR    491 - 560
LCIAAVDKRGLDVDGIYRVSGNLAVVQKLRFLVDRERAVTSDGRYVFPEQPGQEGRLDLDSTEWDDIHVV    561 - 630
TGALKLFLRELPQPLVPPLLLPHFRAALALSESEQCLSQIQELIGSMPKPNHDTLRYLLEHLCRVIAHSD    631 - 700
KNRMTPHNLGIVFGPTLFRPEQETSDPAAHALYPGQLVQLMLTNFTSLFP                        701 - 750
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19911011 2010 Mutation of ARHGAP9 in patients with coronary spastic angina.
19807924 2009 Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17339315 2007 Non-canonical interaction of phosphoinositides with pleckstrin homology domains of Tiam1 and ArhGAP9.
17284314 2007 ArhGAP9, a novel MAP kinase docking protein, inhibits Erk and p38 activation through WW domain binding.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12297274 2002 Human RhoGAP domain-containing proteins: structure, function and evolutionary relationships.
11396949 2001 Isolation of a novel human gene, ARHGAP9, encoding a rho-GTPase activating protein.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.