Property Summary

NCBI Gene PubMed Count 10
PubMed Score 8.06
PubTator Score 10.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
Astrocytoma, Pilocytic 1.900 7.1e-06
atypical teratoid / rhabdoid tumor -1.800 8.8e-03
Breast cancer -1.400 3.3e-02
colon cancer -1.900 2.4e-03
ductal carcinoma in situ -1.500 1.4e-04
ependymoma 1.600 1.7e-04
gastric cancer 1.200 9.7e-03
group 3 medulloblastoma -1.400 1.1e-02
head and neck cancer -1.700 3.3e-03
interstitial cystitis -1.300 1.6e-03
invasive ductal carcinoma -2.200 6.1e-05
lung adenocarcinoma -1.200 9.4e-14
lung cancer -3.000 9.0e-05
malignant mesothelioma -4.100 1.2e-08
medulloblastoma, large-cell -2.700 1.8e-04
non-small cell lung cancer -2.799 2.8e-34
osteosarcoma -2.114 3.1e-03
ovarian cancer -4.300 1.8e-17
pancreatic cancer 1.700 9.9e-04
pancreatic carcinoma 1.700 9.9e-04
pituitary cancer -2.000 4.7e-05
primitive neuroectodermal tumor -1.600 3.0e-02
psoriasis -1.200 7.0e-06
subependymal giant cell astrocytoma 1.577 1.3e-02
tuberculosis 1.300 4.9e-03

Gene RIF (5)

AA Sequence

MSAQSLLHSVFSCSSPASSSAASAKGFSKRKLRQTRSLDPALIGGCGSDEAGAEGSARGATAGRLYSPSL      1 - 70
PAESLGPRLASSSRGPPPRATRLPPPGPLCSSFSTPSTPQEKSPSGSFHFDYEVPLGRGGLKKSMAWDLP     71 - 140
SVLAGPASSRSASSILCSSGGGPNGIFASPRRWLQQRKFQSPPDSRGHPYVVWKSEGDFTWNSMSGRSVR    141 - 210
LRSVPIQSLSELERARLQEVAFYQLQQDCDLSCQITIPKDGQKRKKSLRKKLDSLGKEKNKDKEFIPQAF    211 - 280
GMPLSQVIANDRAYKLKQDLQRDEQKDASDFVASLLPFGNKRQNKELSSSNSSLSSTSETPNESTSPNTP    281 - 350
EPAPRARRRGAMSVDSITDLDDNQSRLLEALQLSLPAEAQSKKEKARDKKLSLNPIYRQVPRLVDSCCQH    351 - 420
LEKHGLQTVGIFRVGSSKKRVRQLREEFDRGIDVSLEEEHSVHDVAALLKEFLRDMPDPLLTRELYTAFI    421 - 490
NTLLLEPEEQLGTLQLLIYLLPPCNCDTLHRLLQFLSIVARHADDNISKDGQEVTGNKMTSLNLATIFGP    491 - 560
NLLHKQKSSDKEFSVQSSARAEESTAIIAVVQKMIENYEALFMVPPDLQNEVLISLLETDPDVVDYLLRR    561 - 630
KASQSSSPDMLQSEVSFSVGGRHSSTDSNKASSGDISPYDNNSPVLSERSLLAMQEDAAPGGSEKLYRVP    631 - 700
GQFMLVGHLSSSKSRESSPGPRLGKDLSEEPFDIWGTWHSTLKSGSKDPGMTGSSGDIFESSSLRAGPCS    701 - 770
LSQGNLSPNWPRWQGSPAELDSDTQGARRTQAAAPATEGRAHPAVSRACSTPHVQVAGKAERPTARSEQY    771 - 840
LTLSGAHDLSESELDVAGLQSRATPQCQRPHGSGRDDKRPPPPYPGPGKPAAAAAWIQGPPEGVETPTDQ    841 - 910
GGQAAEREQQVTQKKLSSANSLPAGEQDSPRLGDAGWLDWQRERWQIWELLSTDNPDALPETLV          911 - 974
//

Text Mined References (14)

PMID Year Title