Property Summary

NCBI Gene PubMed Count 23
PubMed Score 17.49
PubTator Score 11.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
gastric cancer 1.100 1.9e-03
ependymoma 1.100 3.1e-02
psoriasis -2.100 2.4e-04
osteosarcoma 1.679 1.3e-03
glioblastoma -1.800 2.5e-04
medulloblastoma -1.500 1.7e-03
atypical teratoid / rhabdoid tumor -2.500 4.8e-05
medulloblastoma, large-cell -2.100 1.6e-03
primitive neuroectodermal tumor -1.600 4.8e-03
Crohn's disease -1.277 8.3e-04
ulcerative colitis -1.416 3.3e-03
autosomal dominant Emery-Dreifuss muscul... 1.023 1.5e-02
hereditary spastic paraplegia -1.190 2.9e-02
juvenile dermatomyositis 1.146 4.3e-06
Amyotrophic Lateral Sclerosis 1.213 1.6e-04
acute quadriplegic myopathy 1.148 4.5e-03
tuberculosis -1.100 3.1e-05
non-small cell lung cancer -1.044 2.0e-11
intraductal papillary-mucinous carcinoma... 1.700 6.1e-03
intraductal papillary-mucinous neoplasm ... 2.000 7.3e-03
Breast cancer 2.800 2.6e-02
adult high grade glioma -1.700 1.7e-06
aldosterone-producing adenoma -1.371 2.6e-02
spina bifida -1.476 2.8e-02
invasive ductal carcinoma -1.100 8.1e-03
ovarian cancer -1.600 3.4e-06
Down syndrome 1.100 2.3e-03

Gene RIF (9)

PMID Text
25961434 This newly identified miR-744/ARHGAP5 pathway provides further insight into the progression and metastasis of NPC and indicates potential novel therapeutic targets for NPC.
24316134 Ectopic expression of p190B suppressed the miR-494-induced EGFR upregulation.
23653363 Data indicate a role for p120-catenin (amino acids 820-843) domain in the p120-catenin.p190RhoGAP signaling complex assembly and membrane targeting.
23552690 RhoA is down-regulated at cell-cell contacts via p190RhoGAP-B in response to tensional homeostasis.
23474761 The expression level of miR-486-5p was inversely correlated with that of ARHGAP5.
19822667 Results link Cdk5 to Rho-ROCK signaling via Src and p190RhoGAP and implicate Cdk5 in the regulation of cell contraction, attachment, and migration.
18996642 ARHGAP5 (the gene encoding p190-B RhoGAP) is a probable target for the amplification at 14q12, and p190-B RhoGAP promotes cells spreading and migration by negatively regulating RhoA activity in Huh-7 hepatocellular carcinoma cells
16469769 precise control of p190-B Rho GTPase-activating protein activity is critical for normal branching morphogenesis during mammary gland development
14610059 A cell cycle-regulated reduction in endogenous p190 levels is linked to completion of cytokinesis and generation of viable cell progeny.

AA Sequence

MMAKNKEPRPPSYTISIVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTIDFGGRVVNND      1 - 70
HFLYWGDIIQNSEDGVECKIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAAASKLQSAEKLMYICTDQLGL     71 - 140
EQDFEQKQMPEGKLNVDGFLLCIDVSQGCNRKFDDQLKFVNNLFVQLSKSKKPVIIAATKCDECVDHYLR    141 - 210
EVQAFASNKKNLLVVETSARFNVNIETCFTALVQMLDKTRSKPKIIPYLDAYKTQRQLVVTATDKFEKLV    211 - 280
QTVRDYHATWKTVSNKLKNHPDYEEYINLEGTRKARNTFSKHIEQLKQEHIRKRREEYINTLPRAFNTLL    281 - 350
PNLEEIEHLNWSEALKLMEKRADFQLCFVVLEKTPWDETDHIDKINDRRIPFDLLSTLEAEKVYQNHVQH    351 - 420
LISEKRRVEMKEKFKKTLEKIQFISPGQPWEEVMCFVMEDEAYKYITEADSKEVYGRHQREIVEKAKEEF    421 - 490
QEMLFEHSELFYDLDLNATPSSDKMSEIHTVLSEEPRYKALQKLAPDRESLLLKHIGFVYHPTKETCLSG    491 - 560
QNCTDIKVEQLLASSLLQLDHGRLRLYHDSTNIDKVNLFILGKDGLAQELANEIRTQSTDDEYALDGKIY    561 - 630
ELDLRPVDAKSPYFLSQLWTAAFKPHGCFCVFNSIESLSFIGEFIGKIRTEASQIRKDKYMANLPFTLIL    631 - 700
ANQRDSISKNLPILRHQGQQLANKLQCPFVDVPAGTYPRKFNETQIKQALRGVLESVKHNLDVVSPIPAN    701 - 770
KDLSEADLRIVMCAMCGDPFSVDLILSPFLDSHSCSAAQAGQNNSLMLDKIIGEKRRRIQITILSYHSSI    771 - 840
GVRKDELVHGYILVYSAKRKASMGMLRAFLSEVQDTIPVQLVAVTDSQADFFENEAIKELMTEGEHIATE    841 - 910
ITAKFTALYSLSQYHRQTEVFTLFFSDVLEKKNMIENSYLSDNTRESTHQSEDVFLPSPRDCFPYNNYPD    911 - 980
SDDDTEAPPPYSPIGDDVQLLPTPSDRSRYRLDLEGNEYPIHSTPNCHDHERNHKVPPPIKPKPVVPKTN    981 - 1050
VKKLDPNLLKTIEAGIGKNPRKQTSRVPLAHPEDMDPSDNYAEPIDTIFKQKGYSDEIYVVPDDSQNRIK   1051 - 1120
IRNSFVNNTQGDEENGFSDRTSKSHGERRPSKYKYKSKTLFSKAKSYYRRTHSDASDDEAFTTSKTKRKG   1121 - 1190
RHRGSEEDPLLSPVETWKGGIDNPAITSDQELDDKKMKKKTHKVKEDKKQKKKTKNFNPPTRRNWESNYF   1191 - 1260
GMPLQDLVTAEKPIPLFVEKCVEFIEDTGLCTEGLYRVSGNKTDQDNIQKQFDQDHNINLVSMEVTVNAV   1261 - 1330
AGALKAFFADLPDPLIPYSLHPELLEAAKIPDKTERLHALKEIVKKFHPVNYDVFRYVITHLNRVSQQHK   1331 - 1400
INLMTADNLSICFWPTLMRPDFENREFLSTTKIHQSVVETFIQQCQFFFYNGEIVETTNIVAPPPPSNPG   1401 - 1470
QLVEPMVPLQLPPPLQPQLIQPQLQTDPLGII                                         1471 - 1502
//

Text Mined References (33)

PMID Year Title
25961434 2015 MiR-744 functions as a proto-oncogene in nasopharyngeal carcinoma progression and metastasis via transcriptional control of ARHGAP5.
24316134 2014 Ionizing radiation-inducible miR-494 promotes glioma cell invasion through EGFR stabilization by targeting p190B rhoGAP.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23653363 2013 Interaction of p190RhoGAP with C-terminal domain of p120-catenin modulates endothelial cytoskeleton and permeability.
23622247 2013 14-3-3 proteins interact with a hybrid prenyl-phosphorylation motif to inhibit G proteins.
23552690 2013 RhoA is down-regulated at cell-cell contacts via p190RhoGAP-B in response to tensional homeostasis.
23474761 2014 Downregulation of miR-486-5p contributes to tumor progression and metastasis by targeting protumorigenic ARHGAP5 in lung cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19822667 2009 Cdk5-dependent regulation of Rho activity, cytoskeletal contraction, and epithelial cell migration via suppression of Src and p190RhoGAP.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18996642 2009 A novel amplification target, ARHGAP5, promotes cell spreading and migration by negatively regulating RhoA in Huh-7 hepatocellular carcinoma cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16777052 2006 Nitroproteins from a human pituitary adenoma tissue discovered with a nitrotyrosine affinity column and tandem mass spectrometry.
16469769 2006 P190-B Rho GTPase-activating protein overexpression disrupts ductal morphogenesis and induces hyperplastic lesions in the developing mammary gland.
15588985 2005 Substrate-trapping techniques in the identification of cellular PTP targets.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14610059 2003 p190RhoGAP is cell cycle regulated and affects cytokinesis.
12842009 2003 Rnd proteins function as RhoA antagonists by activating p190 RhoGAP.
12554790 2003 Protein tyrosine phosphatase PTP20 induces actin cytoskeleton reorganization by dephosphorylating p190 RhoGAP in rat ovarian granulosa cells stimulated with follicle-stimulating hormone.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10939588 2000 P190-B, a Rho-GTPase-activating protein, is differentially expressed in terminal end buds and breast cancer.
10713673 2000 RAFTK/Pyk2 tyrosine kinase mediates the association of p190 RhoGAP with RasGAP and is involved in breast cancer cell invasion.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8537347 1995 p190-B, a new member of the Rho GAP family, and Rho are induced to cluster after integrin cross-linking.
7935432 1994 p190 RhoGAP, the major RasGAP-associated protein, binds GTP directly.
1689011 1990 Phosphorylation of GAP and GAP-associated proteins by transforming and mitogenic tyrosine kinases.