Property Summary

NCBI Gene PubMed Count 25
PubMed Score 18.76
PubTator Score 11.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
acute quadriplegic myopathy 1.148 4.5e-03
adult high grade glioma -1.100 4.2e-03
aldosterone-producing adenoma -1.007 3.2e-02
Amyotrophic lateral sclerosis 1.213 1.6e-04
atypical teratoid / rhabdoid tumor -2.500 4.8e-05
autosomal dominant Emery-Dreifuss muscul... 1.023 1.5e-02
Breast cancer 2.800 2.6e-02
Crohn's disease -1.277 8.3e-04
Down syndrome 1.100 2.3e-03
ependymoma 1.100 3.1e-02
gastric cancer 1.100 1.9e-03
glioblastoma -1.400 9.8e-07
group 4 medulloblastoma -1.400 2.0e-05
hereditary spastic paraplegia -1.190 2.9e-02
intraductal papillary-mucinous carcinoma... 1.100 4.8e-02
intraductal papillary-mucinous neoplasm ... 1.500 3.9e-03
invasive ductal carcinoma -1.100 8.1e-03
juvenile dermatomyositis 1.146 4.3e-06
medulloblastoma, large-cell -2.100 1.6e-03
non-small cell lung cancer -1.044 2.0e-11
osteosarcoma 1.679 1.3e-03
ovarian cancer -1.100 5.1e-03
primitive neuroectodermal tumor -1.600 4.8e-03
psoriasis -2.100 2.4e-04
spina bifida -1.476 2.8e-02
tuberculosis -1.100 3.1e-05
ulcerative colitis -1.416 3.3e-03

 GWAS Trait (1)

Gene RIF (11)

AA Sequence

MMAKNKEPRPPSYTISIVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTIDFGGRVVNND      1 - 70
HFLYWGDIIQNSEDGVECKIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAAASKLQSAEKLMYICTDQLGL     71 - 140
EQDFEQKQMPEGKLNVDGFLLCIDVSQGCNRKFDDQLKFVNNLFVQLSKSKKPVIIAATKCDECVDHYLR    141 - 210
EVQAFASNKKNLLVVETSARFNVNIETCFTALVQMLDKTRSKPKIIPYLDAYKTQRQLVVTATDKFEKLV    211 - 280
QTVRDYHATWKTVSNKLKNHPDYEEYINLEGTRKARNTFSKHIEQLKQEHIRKRREEYINTLPRAFNTLL    281 - 350
PNLEEIEHLNWSEALKLMEKRADFQLCFVVLEKTPWDETDHIDKINDRRIPFDLLSTLEAEKVYQNHVQH    351 - 420
LISEKRRVEMKEKFKKTLEKIQFISPGQPWEEVMCFVMEDEAYKYITEADSKEVYGRHQREIVEKAKEEF    421 - 490
QEMLFEHSELFYDLDLNATPSSDKMSEIHTVLSEEPRYKALQKLAPDRESLLLKHIGFVYHPTKETCLSG    491 - 560
QNCTDIKVEQLLASSLLQLDHGRLRLYHDSTNIDKVNLFILGKDGLAQELANEIRTQSTDDEYALDGKIY    561 - 630
ELDLRPVDAKSPYFLSQLWTAAFKPHGCFCVFNSIESLSFIGEFIGKIRTEASQIRKDKYMANLPFTLIL    631 - 700
ANQRDSISKNLPILRHQGQQLANKLQCPFVDVPAGTYPRKFNETQIKQALRGVLESVKHNLDVVSPIPAN    701 - 770
KDLSEADLRIVMCAMCGDPFSVDLILSPFLDSHSCSAAQAGQNNSLMLDKIIGEKRRRIQITILSYHSSI    771 - 840
GVRKDELVHGYILVYSAKRKASMGMLRAFLSEVQDTIPVQLVAVTDSQADFFENEAIKELMTEGEHIATE    841 - 910
ITAKFTALYSLSQYHRQTEVFTLFFSDVLEKKNMIENSYLSDNTRESTHQSEDVFLPSPRDCFPYNNYPD    911 - 980
SDDDTEAPPPYSPIGDDVQLLPTPSDRSRYRLDLEGNEYPIHSTPNCHDHERNHKVPPPIKPKPVVPKTN    981 - 1050
VKKLDPNLLKTIEAGIGKNPRKQTSRVPLAHPEDMDPSDNYAEPIDTIFKQKGYSDEIYVVPDDSQNRIK   1051 - 1120
IRNSFVNNTQGDEENGFSDRTSKSHGERRPSKYKYKSKTLFSKAKSYYRRTHSDASDDEAFTTSKTKRKG   1121 - 1190
RHRGSEEDPLLSPVETWKGGIDNPAITSDQELDDKKMKKKTHKVKEDKKQKKKTKNFNPPTRRNWESNYF   1191 - 1260
GMPLQDLVTAEKPIPLFVEKCVEFIEDTGLCTEGLYRVSGNKTDQDNIQKQFDQDHNINLVSMEVTVNAV   1261 - 1330
AGALKAFFADLPDPLIPYSLHPELLEAAKIPDKTERLHALKEIVKKFHPVNYDVFRYVITHLNRVSQQHK   1331 - 1400
INLMTADNLSICFWPTLMRPDFENREFLSTTKIHQSVVETFIQQCQFFFYNGEIVETTNIVAPPPPSNPG   1401 - 1470
QLVEPMVPLQLPPPLQPQLIQPQLQTDPLGII                                         1471 - 1502
//

Text Mined References (35)

PMID Year Title