Property Summary

NCBI Gene PubMed Count 30
PubMed Score 4.55
PubTator Score 518.41

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
nephrosclerosis 1.031 1.3e-04
malignant mesothelioma 2.300 4.8e-08
cutaneous lupus erythematosus 1.500 3.5e-03
psoriasis -2.000 3.5e-05
osteosarcoma -3.748 5.6e-10
lung cancer -1.500 1.8e-04
interstitial cystitis 1.800 1.8e-03
subependymal giant cell astrocytoma 2.073 1.3e-02
gastric carcinoma 1.400 1.4e-02
ovarian cancer 1.400 3.5e-04

Gene RIF (16)

PMID Text
26095815 Placental HA-1 expression is regulated by oxygen and is increased in the syncytial nuclear aggregates and syncytiotrophoblast of preeclamptic as compared to control placentas.
24086303 study shows that HMHA1 acts as a RhoGAP to regulate GTPase activity, cytoskeletal remodeling and cell spreading, which are crucial functions in normal hematopoietic and cancer cells
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20509834 the information on allele and genotype frequencies of HA-1 and HA-2 in a Taiwanese population
19913121 Observational study of gene-disease association. (HuGE Navigator)
19234124 study examined antigenic presentation & T-cell recognition of HA-1, a prototypic autosomal mHag derived from single nucleotide dimorphism (HA-1(H) versus HA-1(R)) in the HMHA1 gene; results define the molecular mechanisms governing immunogenicity of HA-1
18414982 targeting mHags encoded not only by HMHA1, whose aberrant expression in solid tumors has been reported, but also BCL2A1 may bring about beneficial selective graft-versus-tumor effects
18093280 Observational study of gene-disease association. (HuGE Navigator)
17580157 There was no difference in acute rejection rates between the HA-1-matched and -mismatched groups in kidney transplantation.
16984283 Observational study of gene-disease association. (HuGE Navigator)
15593299 Observational study of gene-disease association. (HuGE Navigator)
15593299 the incidence of the HA-1 168His allele is significantly lower in Sjogren's syndrome patients than in controls
15498856 Pre-existing HA-1-specific T cells are observed in cord blood samples. Both circulating and ex vivo-generated HA-1-specific T cells show specific and hematopoietic restricted lysis of HLA-A2+/HA-1+ target cells, including leukemic cells.
15350465 In bone marrow transplant recipients and their genetically HLA-identical siblings, the presence of different alleles of two minor histocompatibility antigen genes is studied.
12091347 HA-1-specific CTLs restricted by nonself HLA-A2 molecules can be generated in an HLA-A2-mismatched setting.
11920221 The intensity of the tetramer-staining of the HA-1/HA-2-specific cytotoxic T cells strongly correlates with their capability to recognize mHag positive target cells.

AA Sequence

MFSRKKRELMKTPSISKKNRAGSPSPQPSGELPRKDGADAVFPGPSLEPPAGSSGVKATGTLKRPTSLSR      1 - 70
HASAAGFPLSGAASWTLGRSHRSPLTAASPGELPTEGAGPDVVEDISHLLADVARFAEGLEKLKECVLRD     71 - 140
DLLEARRPRAHECLGEALRVMHQIISKYPLLNTVETLTAAGTLIAKVKAFHYESNNDLEKQEFEKALETI    141 - 210
AVAFSSTVSEFLMGEVDSSTLLAVPPGDSSQSMESLYGPGSEGTPPSLEDCDAGCLPAEEVDVLLQRCEG    211 - 280
GVDAALLYAKNMAKYMKDLISYLEKRTTLEMEFAKGLQKIAHNCRQSVMQEPHMPLLSIYSLALEQDLEF    281 - 350
GHSMVQAVGTLQTQTFMQPLTLRRLEHEKRRKEIKEAWHRAQRKLQEAESNLRKAKQGYVQRCEDHDKAR    351 - 420
FLVAKAEEEQAGSAPGAGSTATKTLDKRRRLEEEAKNKAEEAMATYRTCVADAKTQKQELEDTKVTALRQ    421 - 490
IQEVIRQSDQTIKSATISYYQMMHMQTAPLPVHFQMLCESSKLYDPGQQYASHVRQLQRDQEPDVHYDFE    491 - 560
PHVSANAWSPVMRARKSSFNVSDVARPEAAGSPPEEGGCTEGTPAKDHRAGRGHQVHKSWPLSISDSDSG    561 - 630
LDPGPGAGDFKKFERTSSSGTMSSTEELVDPDGGAGASAFEQADLNGMTPELPVAVPSGPFRHEGLSKAA    631 - 700
RTHRLRKLRTPAKCRECNSYVYFQGAECEECCLACHKKCLETLAIQCGHKKLQGRLQLFGQDFSHAARSA    701 - 770
PDGVPFIVKKCVCEIERRALRTKGIYRVNGVKTRVEKLCQAFENGKELVELSQASPHDISNVLKLYLRQL    771 - 840
PEPLISFRLYHELVGLAKDSLKAEAEAKAASRGRQDGSESEAVAVALAGRLRELLRDLPPENRASLQYLL    841 - 910
RHLRRIVEVEQDNKMTPGNLGIVFGPTLLRPRPTEATVSLSSLVDYPHQARVIETLIVHYGLVFEEEPEE    911 - 980
TPGGQDESSNQRAEVVVQVPYLEAGEAVVYPLQEAAADGCRESRVVSNDSDSDLEEASELLSSSEASALG    981 - 1050
HLSFLEQQQSEASLEVASGSHSGSEEQLEATAREDGDGDEDGPAQQLSGFNTNQSNNVLQAPLPPMRLRG   1051 - 1120
GRMTLGSCRERQPEFV                                                         1121 - 1136
//

Text Mined References (46)

PMID Year Title
26095815 2015 Trophoblast expression of the minor histocompatibility antigen HA-1 is regulated by oxygen and is increased in placentas from preeclamptic women.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24086303 2013 The human minor histocompatibility antigen 1 is a RhoGAP.
23571587 2013 Variants in the ATP-binding cassette transporter (ABCA7), apolipoprotein E ?4,and the risk of late-onset Alzheimer disease in African Americans.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20509834 2010 Minor histocompatibility antigen HA-1 and HA-2 polymorphisms in Taiwan: frequency and application in hematopoietic stem cell transplantation.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
19234124 2009 Secondary anchor polymorphism in the HA-1 minor histocompatibility antigen critically affects MHC stability and TCR recognition.
18414982 2008 Aberrant expression of BCL2A1-restricted minor histocompatibility antigens in melanoma cells: application for allogeneic transplantation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18093280 2008 Role of minor histocompatibility antigens in renal transplantation.
17580157 2007 HA-1 mismatch has significant effect in chronic allograft nephropathy in clinical renal transplantation.
16984283 2006 Role of non-HLA genetic polymorphisms in graft-versus-host disease after haematopoietic stem cell transplantation.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16399573 2006 Therapeutic and diagnostic applications of minor histocompatibility antigen HA-1 and HA-2 disparities in allogeneic hematopoietic stem cell transplantation: a survey of different populations.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16202172 2005 Sequence diversity within the HA-1 gene as detected by melting temperature assay without oligonucleotide probes.
15593299 2005 Homozygosity for the 168His variant of the minor histocompatibility antigen HA-1 is associated with reduced risk of primary Sjögren's syndrome.
15498856 2005 Cord blood comprises antigen-experienced T cells specific for maternal minor histocompatibility antigen HA-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15350465 Minor histocompatibility antigen HA-1 and HPA-5 polymorphisms in HLA-identical related bone marrow transplantation.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14502255 2003 Quantification of the HA-1 gene product at the RNA level; relevance for immunotherapy of hematological malignancies.
12601144 2003 Hematopoiesis-restricted minor histocompatibility antigens HA-1- or HA-2-specific T cells can induce complete remissions of relapsed leukemia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12091347 2002 Generation of minor histocompatibility antigen HA-1-specific cytotoxic T cells restricted by nonself HLA molecules: a potential strategy to treat relapsed leukemia after HLA-mismatched stem cell transplantation.
11965046 2002 Expression of minor histocompatibility antigen, HA-1, in solid tumor cells.
11920221 2000 HLA class I-minor histocompatibility antigen tetramers select cytotoxic T cells with high avidity to the natural ligand.
11095984 2000 Genomic organization of the human cholesterol-responsive ABC transporter ABCA7: tandem linkage with the minor histocompatibility antigen HA-1 gene.
10958358 2000 Genomic typing of minor histocompatibility antigen HA-1 by reference strand mediated conformation analysis (RSCA).
9820596 1998 Genomic identification of the minor histocompatibility antigen HA-1 locus by allele-specific PCR.
9820595 1998 Definition of the gene encoding the minor histocompatibility antigen HA-1 and typing for HA-1 from genomic DNA.
9798702 1998 HA-1 and the SMCY-derived peptide FIDSYICQV (H-Y) are immunodominant minor histocompatibility antigens after bone marrow transplantation.
9461441 1998 The minor histocompatibility antigen HA-1: a diallelic gene with a single amino acid polymorphism.
9039502 1996 Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.
8843592 1996 Functional expression of minor histocompatibility antigens on human peripheral blood dendritic cells and epidermal Langerhans cells.
8532022 1996 Mismatches of minor histocompatibility antigens between HLA-identical donors and recipients and the development of graft-versus-host disease after bone marrow transplantation.
8260714 1993 Minor histocompatibility antigens HA-1-, -2-, and -4-, and HY-specific cytotoxic T-cell clones inhibit human hematopoietic progenitor cell growth by a mechanism that is dependent on direct cell-cell contact.