Property Summary

NCBI Gene PubMed Count 21
PubMed Score 80.31
PubTator Score 25.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma -2.000 2.9e-02
ependymoma -2.400 2.1e-02
oligodendroglioma -1.800 3.4e-02
glioblastoma -3.400 2.8e-05
osteosarcoma -2.131 5.0e-04
medulloblastoma -3.600 4.8e-05
atypical teratoid / rhabdoid tumor -3.900 5.9e-08
medulloblastoma, large-cell -3.700 6.0e-05
primitive neuroectodermal tumor -2.400 3.4e-03
tuberculosis and treatment for 3 months 1.100 6.9e-05
intraductal papillary-mucinous adenoma (... 1.500 4.4e-04
intraductal papillary-mucinous carcinoma... 1.400 6.4e-03
intraductal papillary-mucinous neoplasm ... 1.700 4.5e-03
lung cancer 1.700 2.1e-02
interstitial cystitis -1.900 4.5e-05
adult high grade glioma -3.100 6.6e-05
pilocytic astrocytoma -1.800 1.7e-03
spina bifida -1.792 3.6e-02
ductal carcinoma in situ 1.100 8.2e-03
invasive ductal carcinoma 2.000 2.2e-03
ovarian cancer -1.600 7.6e-08
pituitary cancer 1.300 2.2e-02

Gene RIF (15)

PMID Text
23226367 Cdh1-APC together with the RhoA regulators p250GAP and Smurf1 controls axon growth in the mammalian brain
22530067 the p250GAP gene might be a new candidate gene for susceptibility to schizophrenia.
20308060 The PX-RICS-14-3-3zeta/theta complex couples N-cadherin-beta-catenin with dynein-dynactin to mediate its export from the endoplasmic reticulum.
18577589 miR132-p250GAP pathway plays a key role in activity-dependent structural and functional plasticity.
18451111 Results suggest that PX-RICS ensures the efficient entry of the N-cadherin/beta-catenin complex into the secretory pathway, and thereby regulates the amount of N-cadherin available for cell adhesion and FGFR4-mediated signaling.
18187620 Knockdown of Rho GTPase activating protein 32 (ARHGAP32; RICS) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17663722 Results suggest that a splice variant of RICS, PX-RICS, is involved in early brain development including extension of axons and dendrites, and postnatal remodeling and fine-tuning of neural circuits.
12857875 p250GAP is likely to be involved in actin reorganization in dendritic spines
12857875 p250GAP may be involved in NMDA receptor activity-dependent actin reorganization in dendritic spines
12819203 GC-GAP may play a role in dendritic morphogenesis and also possibly in neural/glial cell proliferation
12788081 is phosphorylated by Fyn in oligodendrocytes
12531901 RICS may regulate dendritic spine morphology and strength by modulating Rho GTPases
12477392 This article analyzes Rac activation during live neutrophil chemotaxis.
12454018 involvement in the regulation of neurite outgrowth by exerting its RhoGAP activity and that its cellular activity may be regulated through interaction with Src-like tyrosine kinases
12446789 These results suggest that Grit, a novel TrkA-interacting protein, regulates neurite outgrowth by modulating the Rho family of small GTPases.

AA Sequence

METESESSTLGDDSVFWLESEVIIQVTDCEEEEREEKFRKMKSSVHSEEDDFVPELHRNVHPRERPDWEE      1 - 70
TLSAMARGADVPEIPGDLTLKTCGSTASMKVKHVKKLPFTKGHFPKMAECAHFHYENVEFGSIQLSLSEE     71 - 140
QNEVMKNGCESKELVYLVQIACQGKSWIVKRSYEDFRVLDKHLHLCIYDRRFSQLSELPRSDTLKDSPES    141 - 210
VTQMLMAYLSRLSAIAGNKINCGPALTWMEIDNKGNHLLVHEESSINTPAVGAAHVIKRYTARAPDELTL    211 - 280
EVGDIVSVIDMPPKVLSTWWRGKHGFQVGLFPGHCVELINQKVPQSVTNSVPKPVSKKHGKLITFLRTFM    281 - 350
KSRPTKQKLKQRGILKERVFGCDLGEHLLNSGFEVPQVLQSCTAFIERYGIVDGIYRLSGVASNIQRLRH    351 - 420
EFDSEHVPDLTKEPYVQDIHSVGSLCKLYFRELPNPLLTYQLYEKFSDAVSAATDEERLIKIHDVIQQLP    421 - 490
PPHYRTLEFLMRHLSLLADYCSITNMHAKNLAIVWAPNLLRSKQIESACFSGTAAFMEVRIQSVVVEFIL    491 - 560
NHVDVLFSGRISMAMQEGAASLSRPKSLLVSSPSTKLLTLEEAQARTQAQVNSPIVTENKYIEVGEGPAA    561 - 630
LQGKFHTIIEFPLERKRPQNKMKKSPVGSWRSFFNLGKSSSVSKRKLQRNESEPSEMKAMALKGGRAEGT    631 - 700
LRSAKSEESLTSLHAVDGDSKLFRPRRPRSSSDALSASFNGEMLGNRCNSYDNLPHDNESEEEGGLLHIP    701 - 770
ALMSPHSAEDVDLSPPDIGVASLDFDPMSFQCSPPKAESECLESGASFLDSPGYSKDKPSANKKDAETGS    771 - 840
SQCQTPGSTASSEPVSPLQEKLSPFFTLDLSPTEDKSSKPSSFTEKVVYAFSPKIGRKLSKSPSMSISEP    841 - 910
ISVTLPPRVSEVIGTVSNTTAQNASSSTWDKCVEERDATNRSPTQIVKMKTNETVAQEAYESEVQPLDQV    911 - 980
AAEEVELPGKEDQSVSSSQSKAVASGQTQTGAVTHDPPQDSVPVSSVSLIPPPPPPKNVARMLALALAES    981 - 1050
AQQASTQSLKRPGTSQAGYTNYGDIAVATTEDNLSSSYSAVALDKAYFQTDRPAEQFHLQNNAPGNCDHP   1051 - 1120
LPETTATGDPTHSNTTESGEQHHQVDLTGNQPHQAYLSGDPEKARITSVPLDSEKSDDHVSFPEDQSGKN   1121 - 1190
SMPTVSFLDQDQSPPRFYSGDQPPSYLGASVDKLHHPLEFADKSPTPPNLPSDKIYPPSGSPEENTSTAT   1191 - 1260
MTYMTTTPATAQMSTKEASWDVAEQPTTADFAAATLQRTHRTNRPLPPPPSQRSAEQPPVVGQVQAATNI   1261 - 1330
GLNNSHKVQGVVPVPERPPEPRAMDDPASAFISDSGAAAAQCPMATAVQPGLPEKVRDGARVPLLHLRAE   1331 - 1400
SVPAHPCGFPAPLPPTRMMESKMIAAIHSSSADATSSSNYHSFVTASSTSVDDALPLPLPVPQPKHASQK   1401 - 1470
TVYSSFARPDVTTEPFGPDNCLHFNMTPNCQYRPQSVPPHHNKLEQHQVYGARSEPPASMGLRYNTYVAP   1471 - 1540
GRNASGHHSKPCSRVEYVSSLSSSVRNTCYPEDIPPYPTIRRVQSLHAPPSSMIRSVPISRTEVPPDDEP   1541 - 1610
AYCPRPLYQYKPYQSSQARSDYHVTQLQPYFENGRVHYRYSPYSSSSSSYYSPDGALCDVDAYGTVQLRP   1611 - 1680
LHRLPNRDFAFYNPRLQGKSLYSYAGLAPRPRANVTGYFSPNDHNVVSMPPAADVKHTYTSWDLEDMEKY   1681 - 1750
RMQSIRRESRARQKVKGPVMSQYDNMTPAVQDDLGGIYVIHLRSKSDPGKTGLLSVAEGKESRHAAKAIS   1751 - 1820
PEGEDRFYRRHPEAEMDRAHHHGGHGSTQPEKPSLPQKQSSLRSRKLPDMGCSLPEHRAHQEASHRQFCE   1821 - 1890
SKNGPPYPQGAGQLDYGSKGIPDTSEPVSYHNSGVKYAASGQESLRLNHKEVRLSKEMERPWVRQPSAPE   1891 - 1960
KHSRDCYKEEEHLTQSIVPPPKPERSHSLKLHHTQNVERDPSVLYQYQPHGKRQSSVTVVSQYDNLEDYH   1961 - 2030
SLPQHQRGVFGGGGMGTYVPPGFPHPQSRTYATALGQGAFLPAELSLQHPETQIHAE                2031 - 2087
//

Text Mined References (27)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
23226367 2012 p250GAP is a novel player in the Cdh1-APC/Smurf1 pathway of axon growth regulation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22530067 2012 The p250GAP gene is associated with risk for schizophrenia and schizotypal personality traits.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20308060 2010 The PX-RICS-14-3-3zeta/theta complex couples N-cadherin-beta-catenin with dynein-dynactin to mediate its export from the endoplasmic reticulum.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18577589 2008 An activity-regulated microRNA controls dendritic plasticity by down-regulating p250GAP.
18451111 2008 PX-RICS mediates ER-to-Golgi transport of the N-cadherin/beta-catenin complex.
17663722 2007 PX-RICS, a novel splicing variant of RICS, is a main isoform expressed during neural development.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12857875 2003 p250GAP, a novel brain-enriched GTPase-activating protein for Rho family GTPases, is involved in the N-methyl-d-aspartate receptor signaling.
12819203 2003 GC-GAP, a Rho family GTPase-activating protein that interacts with signaling adapters Gab1 and Gab2.
12788081 2003 p250GAP, a neural RhoGAP protein, is associated with and phosphorylated by Fyn.
12531901 2003 RICS, a novel GTPase-activating protein for Cdc42 and Rac1, is involved in the beta-catenin-N-cadherin and N-methyl-D-aspartate receptor signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12477392 2002 Spatial and temporal analysis of Rac activation during live neutrophil chemotaxis.
12454018 2003 Characterization of a brain-specific Rho GTPase-activating protein, p200RhoGAP.
12446789 2002 Grit, a GTPase-activating protein for the Rho family, regulates neurite extension through association with the TrkA receptor and N-Shc and CrkL/Crk adapter molecules.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.