Property Summary

NCBI Gene PubMed Count 18
PubMed Score 9.72
PubTator Score 5.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Rheumatoid Arthritis 1.800 4.7e-02
astrocytic glioma -1.500 3.6e-02
oligodendroglioma -1.300 3.0e-02
group 4 medulloblastoma -2.400 9.9e-05
atypical teratoid / rhabdoid tumor -1.300 1.5e-02
medulloblastoma, large-cell -2.500 5.4e-05
primitive neuroectodermal tumor -1.300 3.4e-03
juvenile dermatomyositis 1.231 9.2e-09
non-small cell lung cancer -2.029 2.6e-16
intraductal papillary-mucinous carcinoma... -2.400 2.4e-02
lung cancer -3.200 1.1e-05
interstitial cystitis 1.200 4.9e-05
lung adenocarcinoma -1.600 4.0e-15
adult high grade glioma -1.100 4.5e-02
non primary Sjogren syndrome sicca -1.100 2.3e-02
lung carcinoma -1.800 2.5e-09
Breast cancer -1.400 4.5e-05
ulcerative colitis 2.300 5.1e-06
ovarian cancer -1.400 6.0e-04
dermatomyositis 1.200 7.6e-03

Gene RIF (7)

PMID Text
25963656 Data indicate that through GTPase-activating proteins ArhGAP29 complex formation Rap1 GTP-binding protein spatially restricts Rho-mediated signaling, which is necessary for endothelial barrier potentiation.
25163644 Genetic variants in ARHGAP29 contribute to the development of nonsyndromic cleft lip with cleft palate.
24635173 We identified genetic variants in TGFB3 and ARHGAP29 associated with suboptimal healing outcome.
23798437 Rasip1-ArhGAP29 pathway also functions in Rap1-mediated regulation of endothelial junctions, which controls endothelial barrier function
23008150 ARHGAP29 is the etiologic gene for the cleft lip with or without cleft palate locus identified by genome-wide association on chromosome 1p22.
19911011 Observational study of gene-disease association. (HuGE Navigator)
17488656 PARG1 expression was substantially reduced & it displayed at least partial promoter methylation in all investigated mantle-cell lines & in 31 primary cases. PARG1 is a strong candidate tumor suppressor gene in MCL.

AA Sequence

MIAHKQKKTKKKRAWASGQLSTDITTSEMGLKSLSSNSIFDPDYIKELVNDIRKFSHMLLYLKEAIFSDC      1 - 70
FKEVIHIRLEELLRVLKSIMNKHQNLNSVDLQNAAEMLTAKVKAVNFTEVNEENKNDLFQEVFSSIETLA     71 - 140
FTFGNILTNFLMGDVGNDSLLRLPVSRETKSFENVSVESVDSSSEKGNFSPLELDNVLLKNTDSIELALS    141 - 210
YAKTWSKYTKNIVSWVEKKLNLELESTRNMVKLAEATRTNIGIQEFMPLQSLFTNALLNDIESSHLLQQT    211 - 280
IAALQANKFVQPLLGRKNEMEKQRKEIKELWKQEQNKMLEAENALKKAKLLCMQRQDEYEKAKSSMFRAE    281 - 350
EEHLSSSGGLAKNLNKQLEKKRRLEEEALQKVEEANELYKVCVTNVEERRNDLENTKREILAQLRTLVFQ    351 - 420
CDLTLKAVTVNLFHMQHLQAASLADSLQSLCDSAKLYDPGQEYSEFVKATNSTEEEKVDGNVNKHLNSSQ    421 - 490
PSGFGPANSLEDVVRLPDSSNKIEEDRCSNSADITGPSFIRSWTFGMFSDSESTGGSSESRSLDSESISP    491 - 560
GDFHRKLPRTPSSGTMSSADDLDEREPPSPSETGPNSLGTFKKTLMSKAALTHKFRKLRSPTKCRDCEGI    561 - 630
VVFQGVECEECLLVCHRKCLENLVIICGHQKLPGKIHLFGAEFTQVAKKEPDGIPFILKICASEIENRAL    631 - 700
CLQGIYRVCGNKIKTEKLCQALENGMHLVDISEFSSHDICDVLKLYLRQLPEPFILFRLYKEFIDLAKEI    701 - 770
QHVNEEQETKKNSLEDKKWPNMCIEINRILLKSKDLLRQLPASNFNSLHFLIVHLKRVVDHAEENKMNSK    771 - 840
NLGVIFGPSLIRPRPTTAPITISSLAEYSNQARLVEFLITYSQKIFDGSLQPQDVMCSIGVVDQGCFPKP    841 - 910
LLSPEERDIERSMKSLFFSSKEDIHTSESESKIFERATSFEESERKQNALGKCDACLSDKAQLLLDQEAE    911 - 980
SASQKIEDGKTPKPLSLKSDRSTNNVERHTPRTKIRPVSLPVDRLLLASPPNERNGRNMGNVNLDKFCKN    981 - 1050
PAFEGVNRKDAATTVCSKFNGFDQQTLQKIQDKQYEQNSLTAKTTMIMPSALQEKGVTTSLQISGDHSIN   1051 - 1120
ATQPSKPYAEPVRSVREASERRSSDSYPLAPVRAPRTLQPQHWTTFYKPHAPIISIRGNEEKPASPSAAV   1121 - 1190
PPGTDHDPHGLVVKSMPDPDKASACPGQATGQPKEDSEELGLPDVNPMCQRPRLKRMQQFEDLEGEIPQF   1191 - 1260
V//

Text Mined References (26)

PMID Year Title
25963656 2015 Rap1 Spatially Controls ArhGAP29 To Inhibit Rho Signaling during Endothelial Barrier Regulation.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25163644 2014 Further evidence suggesting a role for variation in ARHGAP29 variants in nonsyndromic cleft lip/palate.
24635173 Digital imaging analysis to assess scar phenotype.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23798437 2013 Rasip1 mediates Rap1 regulation of Rho in endothelial barrier function through ArhGAP29.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23209302 2012 KIF14 negatively regulates Rap1a-Radil signaling during breast cancer progression.
23008150 2012 Expression and mutation analyses implicate ARHGAP29 as the etiologic gene for the cleft lip with or without cleft palate locus identified by genome-wide association on chromosome 1p22.
21502573 2011 Genetic predictors of fibrin D-dimer levels in healthy adults.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19911011 2010 Mutation of ARHGAP9 in patients with coronary spastic angina.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17488656 2007 Promoter methylation of PARG1, a novel candidate tumor suppressor gene in mantle-cell lymphomas.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15752761 2005 PARG1, a protein-tyrosine phosphatase-associated RhoGAP, as a putative Rap2 effector.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11716068 2001 Glioma cell motility is associated with reduced transcription of proapoptotic and proliferation genes: a cDNA microarray analysis.
9305890 1997 A novel GTPase-activating protein for Rho interacts with a PDZ domain of the protein-tyrosine phosphatase PTPL1.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.