Property Summary

NCBI Gene PubMed Count 35
PubMed Score 15.48
PubTator Score 17.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease 1.235 2.8e-03
gastric carcinoma -1.600 2.3e-02
hepatocellular carcinoma -1.400 1.0e-06
interstitial cystitis 1.400 2.5e-03
intraductal papillary-mucinous adenoma (... 1.200 1.4e-03
invasive ductal carcinoma -1.100 3.1e-03
lung adenocarcinoma -1.100 7.1e-11
lung cancer -1.700 1.2e-04
lung carcinoma -1.800 9.5e-30
malignant mesothelioma -3.900 2.0e-07
osteosarcoma -2.072 5.1e-06
pituitary cancer 1.700 3.1e-07
psoriasis -1.100 4.1e-03
sonic hedgehog group medulloblastoma 1.100 1.1e-02
subependymal giant cell astrocytoma 1.049 4.7e-02
tuberculosis 1.300 5.8e-05

Gene RIF (18)

AA Sequence

MEENNDSTENPQQGQGRQNAIKCGWLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDETKPLGTIFLPGNKV      1 - 70
SEHPCNEENPGKFLFEVVPGGDRDRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDT     71 - 140
VRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDSNTDVHTVASL    141 - 210
LKLYLRELPEPVIPYAKYEDFLSCAKLLSKEEEAGVKELAKQVKSLPVVNYNLLKYICRFLDEVQSYSGV    211 - 280
NKMSVQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMISKHDCLFPKDAELQSKPQDGVSNNNEIQ    281 - 350
KKATMGQLQNKENNNTKDSPSRQCSWDKSESPQRSSMNNGSPTALSGSKTNSPKNSVHKLDVSRSPPLMV    351 - 420
KKNPAFNKGSGIVTNGSFSSSNAEGLEKTQTTPNGSLQARRSSSLKVSGTKMGTHSVQNGTVRMGILNSD    421 - 490
TLGNPTNVRNMSWLPNGYVTLRDNKQKEQAGELGQHNRLSTYDNVHQQFSMMNLDDKQSIDSATWSTSSC    491 - 560
EISLPENSNSCRSSTTTCPEQDFFGGNFEDPVLDGPPQDDLSHPRDYESKSDHRSVGGRSSRATSSSDNS    561 - 630
ETFVGNSSSNHSALHSLVSSLKQEMTKQKIEYESRIKSLEQRNLTLETEMMSLHDELDQERKKFTMIEIK    631 - 700
MRNAERAKEDAEKRNDMLQKEMEQFFSTFGELTVEPRRTERGNTIWIQ                          701 - 748
//

Text Mined References (36)

PMID Year Title