Property Summary

NCBI Gene PubMed Count 17
PubMed Score 65.86
PubTator Score 13.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
pancreatic cancer 1.300 6.6e-05
glioblastoma multiforme 1.600 1.2e-16
osteosarcoma -1.694 6.2e-03
posterior fossa group B ependymoma 2.500 1.3e-07
atypical teratoid / rhabdoid tumor 1.300 1.3e-02
primitive neuroectodermal tumor 1.500 2.5e-02
adrenocortical carcinoma -1.464 1.2e-03
pancreatic ductal adenocarcinoma liver m... 1.363 1.7e-02
tuberculosis and treatment for 6 months -1.900 6.8e-03
non-small cell lung cancer -1.696 5.7e-19
sarcoidosis 1.100 7.1e-03
adult high grade glioma 1.500 5.5e-03
group 3 medulloblastoma 1.300 1.0e-02
pilocytic astrocytoma 1.800 3.0e-05
pancreatic carcinoma 1.300 6.6e-05
subependymal giant cell astrocytoma 3.803 1.7e-02
lung adenocarcinoma -1.100 2.6e-08
invasive ductal carcinoma 1.213 7.3e-03
nasopharyngeal carcinoma -1.500 6.9e-06
psoriasis -1.200 3.8e-07
lung carcinoma -2.700 2.8e-28
Breast cancer -1.300 2.0e-10
mucosa-associated lymphoid tissue lympho... 1.172 6.4e-03
ulcerative colitis -1.100 1.3e-03
ovarian cancer -5.200 1.6e-14

Gene RIF (6)

PMID Text
25425145 Results describe ARHGAP18 as a novel negative regulator of sprouting by acting dualistically to limit tip cell formation and to maintain junctional integrity.
21865595 The results define ARHGAP18 as one of the crucial factors for the regulation of RhoA for the control of cell shape, spreading, and migration.
20664062 identification of a novel gene, SENEX, that regulates stress induced premature senescence pathways in endothelial cells involving p16(INK4a) and retinoblastoma protein activation
19065146 This study use Functional MRI and Genome Wide Association Analysis indentic novel gene(ARHGAP18) associated with schizophrenia.
19065146 Observational study of gene-disease association. (HuGE Navigator)
18987618 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MSWLSSSQGVVLTAYHPSGKDQTVGNSHAKAGEEATSSRRYGQYTMNQESTTIKVMEKPPFDRSISQDSL      1 - 70
DELSMEDYWIELENIKKSSENSQEDQEVVVVKEPDEGELEEEWLKEAGLSNLFGESAGDPQESIVFLSTL     71 - 140
TRTQAAAVQKRVETVSQTLRKKNKQYQIPDVRDIFAQQRESKETAPGGTESQSLRTNENKYQGRDDEASN    141 - 210
LVGEEKLIPPEETPAPETDINLEVSFAEQALNQKESSKEKIQKSKGDDATLPSFRLPKDKTGTTRIGDLA    211 - 280
PQDMKKVCHLALIELTALYDVLGIELKQQKAVKIKTKDSGLFCVPLTALLEQDQRKVPGMRIPLIFQKLI    281 - 350
SRIEERGLETEGLLRIPGAAIRIKNLCQELEAKFYEGTFNWESVKQHDAASLLKLFIRELPQPLLSVEYL    351 - 420
KAFQAVQNLPTKKQQLQALNLLVILLPDANRDTLKALLEFLQRVIDNKEKNKMTVMNVAMVMAPNLFMCH    421 - 490
ALGLKSSEQREFVMAAGTANTMHLLIKYQKLLWTIPKFIVNQVRKQNTENHKKDKRAMKKLLKKMAYDRE    491 - 560
KYEKQDKSTNDADVPQGVIRVQAPHLSKVSMAIQLTEELKASDVLARFLSQESGVAQTLKKGEVFLYEIG    561 - 630
GNIGERCLDDDTYMKDLYQLNPNAEWVIKSKPL                                         631 - 663
//

Text Mined References (22)

PMID Year Title
25778702 2015 YAP is essential for tissue tension to ensure vertebrate 3D body shape.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25425145 2014 ARHGAP18: an endogenous inhibitor of angiogenesis, limiting tip formation and stabilizing junctions.
24684796 2014 Heritability and genetic association analysis of cognition in the Diabetes Heart Study.
24347629 2014 Genome-wide association study of periodontal health measured by probing depth in adults ages 18-49 years.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22808956 2012 Genetically distinct subsets within ANCA-associated vasculitis.
21865595 2011 ARHGAP18, a GTPase-activating protein for RhoA, controls cell shape, spreading, and motility.
21269460 2011 Initial characterization of the human central proteome.
20664062 2010 Stress-induced premature senescence mediated by a novel gene, SENEX, results in an anti-inflammatory phenotype in endothelial cells.
19065146 2009 Gene discovery through imaging genetics: identification of two novel genes associated with schizophrenia.
18987618 2009 Screening for replication of genome-wide SNP associations in sporadic ALS.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.